Align AraV, component of Arabinose, fructose, xylose porter (characterized)
to candidate BWI76_RS03270 BWI76_RS03270 sugar ABC transporter ATP-binding protein CymD
Query= TCDB::Q97UF2 (371 letters) >FitnessBrowser__Koxy:BWI76_RS03270 Length = 376 Score = 206 bits (525), Expect = 6e-58 Identities = 119/300 (39%), Positives = 179/300 (59%), Gaps = 22/300 (7%) Query: 8 NLSKIFKKGKTEVKAVDNVSITIDSGMAFGVLGPSGHGKTTFLRLIAGLEEPTSGYIYFD 67 +L KI K+ + KAV + + I G +GPSG K+T LR+IAGLE+ + G IY Sbjct: 5 SLRKIEKRYENGFKAVHGIDLEIHDGEFMVFVGPSGCAKSTTLRMIAGLEDISGGEIYIG 64 Query: 68 NEAVSSPRRVMMSPEKRGIAMVFQNWALYPNMTVFDNIAFPLKLAKVPKDKIENKVKEVS 127 N V+ + P+ RGIAMVFQN+ALYP+ TVFDN+AF LK+ K PKD+I+ +V++ + Sbjct: 65 NRKVND-----LPPKDRGIAMVFQNYALYPHKTVFDNMAFGLKMQKRPKDEIKRRVEDAA 119 Query: 128 EELGLSGVLNRYPKELSGGQMQRTAIARALVKDPKVLLLDEPFSNLDAQIRESARALVRK 187 E+L ++ +L R PKE+SGGQ QR A+ RA+V+ P V L DEP SNLDA++R S R + + Sbjct: 120 EKLEITELLYRKPKEMSGGQRQRVAVGRAIVRKPDVFLFDEPLSNLDAKLRVSMRMKIAQ 179 Query: 188 IQRERK-----LTTLIVSHDPADIFAIANKAGVIVNGKFAQIGTPTEIYEYPATDLIARL 242 + R K T + V+HD + + ++ V+ +G Q+ TPT++Y YP +A Sbjct: 180 LHRSLKEEGHPATMIYVTHDQTEALTLGDRICVLNHGNIMQVDTPTDLYNYPNNKFVASF 239 Query: 243 TG--EINLIQAKIIENNAII-------ANLKVP-LNNMELKGQSN--IVIGLRPDDLTLS 290 G INLI I +NN + + +P + L+G N + G+RP+ ++L+ Sbjct: 240 IGSPSINLIDTAIRKNNERLYVEIAPGVEILIPHSKQVLLEGYINKPVCFGIRPEHISLA 299 Lambda K H 0.317 0.136 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 319 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 371 Length of database: 376 Length adjustment: 30 Effective length of query: 341 Effective length of database: 346 Effective search space: 117986 Effective search space used: 117986 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory