Align ABC transporter for D-Glucose-6-Phosphate, permease component 2 (characterized)
to candidate BWI76_RS23380 BWI76_RS23380 sugar ABC transporter permease
Query= reanno::WCS417:GFF4323 (302 letters) >FitnessBrowser__Koxy:BWI76_RS23380 Length = 296 Score = 100 bits (250), Expect = 3e-26 Identities = 77/252 (30%), Positives = 122/252 (48%), Gaps = 11/252 (4%) Query: 43 TFVLSFTNSTFLPTYKWAGLAQYARLFDNDR-WWVASKNLAVFGGMFIGITLVIGVTLAI 101 +F LSFT + + G+ Y + D +W + + + I + L + +A Sbjct: 30 SFFLSFTEYDLMSPPVFNGIENYRYMLTEDGLFWKSMGVTFAYVFLTIPLKLAFALGIAF 89 Query: 102 FLDQKIRREGFIRTIYLYPMAL-SMIVTGTAWKWLLNPGMGLDKLLRDW-GWEGFR-LDW 158 L+ K+R GF RT Y P L S + W+ L +D LL + G GF ++W Sbjct: 90 VLNFKLRGIGFFRTAYYIPSILGSSVAIAVLWRALF----AIDGLLNSFIGVLGFDPVNW 145 Query: 159 LIDPDRVVYCLVIAAVWQASGFIMAMFLAGLRGVDQSIVRAAQIDGASMPRIYWSVVLPS 218 L +P + + + VWQ G M +FLA L+ V QS AA IDGAS +++ V +P Sbjct: 146 LGEPSLALMSVTLLRVWQF-GSAMVIFLAALQNVPQSQYEAAMIDGASKWQMFMKVTVPL 204 Query: 219 LRPVFFSAVMILAHIAIKSFDLVAAMTAGGPGYSSDLPAMFMYSFTFSRGQMGMGSASA- 277 + PV F ++ A + F +T GGP YS+ L ++++Y F MG G+A A Sbjct: 205 ITPVIFFNFIMQTTQAFQEFTGPYVITGGGPTYSTYLFSLYIYDTAFKYFDMGYGAALAW 264 Query: 278 -ILMLGAILAII 288 + ++ A+ A I Sbjct: 265 VLFLVVAVFAAI 276 Lambda K H 0.330 0.141 0.455 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 306 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 302 Length of database: 296 Length adjustment: 27 Effective length of query: 275 Effective length of database: 269 Effective search space: 73975 Effective search space used: 73975 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory