Align D-xylose 1-dehydrogenase (EC 1.1.1.175) (characterized)
to candidate BWI76_RS16625 BWI76_RS16625 putative oxidoreductase
Query= BRENDA::B8H1Z0 (248 letters) >FitnessBrowser__Koxy:BWI76_RS16625 Length = 294 Score = 105 bits (261), Expect = 1e-27 Identities = 80/246 (32%), Positives = 119/246 (48%), Gaps = 10/246 (4%) Query: 9 LKGKRVVITGGGSGIGAGLTAGFARQGAEVIFLDIADEDSRA------LEAELAGSPIPP 62 L GKR +ITGG SGIG + FAR+GA+V + +E+S A +EAE + P Sbjct: 47 LAGKRALITGGDSGIGRAVAIAFAREGADVAINYLPEEESDAQTVIALIEAEGRQAVAIP 106 Query: 63 VYKRCDLMNLEAIKAVFAEIGDVDVLVNNAGNDDR-HKLADVTGAYWDERINVNLRHMLF 121 R + ++ +E+G +D+LVNNAG L ++T A +D N+ + Sbjct: 107 GDVRDESFCETLVEQAASELGGLDILVNNAGRQQYCESLEELTTADFDATFKTNVYAAFW 166 Query: 122 CTQAVAPGMKKRGGGAVINFGSISWHLGLEDLVLYETAKAGIEGMTRALARELGPDDIRV 181 T+A +K+ A+IN S+ L+ Y KA + T++LA++LGP IRV Sbjct: 167 ITKAALRHLKEH--SAIINTSSVQAFKPSPILLDYAQTKACLVAFTKSLAKQLGPKGIRV 224 Query: 182 TCVVPGNVKTKRQEKWYTPEGEAQIVAAQCLKGRI-VPENVAALVLFLASDDASLCTGHE 240 V PG T Q P+ + + A GR P +A L + LASD S +G Sbjct: 225 NAVAPGPYWTVLQSSGGQPDEKVRQFGADTPLGRPGQPVEIAPLYVTLASDACSFTSGQV 284 Query: 241 YWIDAG 246 + D G Sbjct: 285 WCSDGG 290 Lambda K H 0.319 0.137 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 173 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 248 Length of database: 294 Length adjustment: 25 Effective length of query: 223 Effective length of database: 269 Effective search space: 59987 Effective search space used: 59987 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory