Align xylulokinase; EC 2.7.1.17 (characterized)
to candidate BWI76_RS23660 BWI76_RS23660 pentose kinase
Query= CharProtDB::CH_003784 (484 letters) >FitnessBrowser__Koxy:BWI76_RS23660 Length = 501 Score = 211 bits (537), Expect = 5e-59 Identities = 152/490 (31%), Positives = 230/490 (46%), Gaps = 28/490 (5%) Query: 5 IDLGTSGVKVILLNEQGEVVAAQTEKLTVSRPHPLWSEQDPEQWWQATDRAMKALGDQH- 63 ID+GT + +L G +V + + P WSEQ P WW+A ++ + ++ Sbjct: 8 IDVGTGSTRAAILRVDGTMVGFAQREYEQTTPRAGWSEQAPSLWWRAACECIREVLYRYP 67 Query: 64 -SLQDVKALGIAGQMHGATLLD-AQQRVLRPAILWNDGRCAQECTLLEARVPQSRVIT-- 119 ++ + +G GQMHG LLD + V A+LWND R + AR + + + Sbjct: 68 ETVTQIAVIGACGQMHGTVLLDDCGELVEDRALLWNDKRSQPQVDAFAAREGREKWLAHL 127 Query: 120 GNLMMPGFTAPKLLWVQRHEPEIFRQIDKVLLPKDYLRLRMTGEFASDMSDAAGTMWLDV 179 N + A KL W + H PE + ++ KVL+PKDY+ +TG A+D S+A+ +D Sbjct: 128 NNPPAAAWPAFKLAWWREHHPERWPKLAKVLMPKDYINFMLTGALATDYSEASCYFLMDS 187 Query: 180 AKRDWSDVMLQACDLSRDQMPALYEGSEITGALLPEVAKAWGMAT-VPVVAGGGDNAAGA 238 R WS + L DQ+P L S+I G + P + G+ +PVVAG D AA Sbjct: 188 ETRAWSSQACETFGLRVDQLPELKLSSDIIGQVTPRASDTTGLPVGIPVVAGTSDMAASL 247 Query: 239 VGVGMVDANQAMLSLGTSGVYFAVSEGFLSKPESAVHSFCHALPQRWHLMSVMLSAASCL 298 +G G+ + A S GTS + VS+ L P + + H W +++ + + Sbjct: 248 LGSGVYEPGMASDSTGTSTLITVVSQRPLRHP---LVNNLHLANAAWGGFTILDAGGDAV 304 Query: 299 DWAAKLTGLSNV--PALIAAAQQADESAEPVWFLPYLSGER-TPHNNPQAKGVFFGLTHQ 355 WA + + P L+ A AE + FLPYL+GER H N +A+ FFGL + Sbjct: 305 RWARLALADNQITHPQLLQEAAAVPAGAEGLLFLPYLTGERLAEHTNSRAQ--FFGLQRK 362 Query: 356 HGPNELARAVLEGVGYALADGMDVVHACGIKPQSVTLIGGGARSEYWRQMLADI------ 409 H L RAVLEGV +A + + ACG PQ + GGGARS W ++ A Sbjct: 363 HRRGHLFRAVLEGVAFASWRNLRQLQACGQYPQQMIASGGGARSPLWLEIKAAAYNLPIL 422 Query: 410 -SGQQLDYRTGGDVGPALGAARLAQIAANPEKSLIELLPQLPLEQSHLPDAQRYAAYQPR 468 + Q + TG + +GA A A+ ++ + ++ PD + YQ Sbjct: 423 STRNQENGVTGCGIIAGVGAGLYADFASGVRQT-------VQFDKLISPDPRLRDYYQAC 475 Query: 469 RETFRRLYQQ 478 E F LYQQ Sbjct: 476 SELFDTLYQQ 485 Lambda K H 0.319 0.134 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 621 Number of extensions: 42 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 484 Length of database: 501 Length adjustment: 34 Effective length of query: 450 Effective length of database: 467 Effective search space: 210150 Effective search space used: 210150 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory