Align xylono-1,5-lactonase (EC 3.1.1.110) (characterized)
to candidate BWI76_RS23720 BWI76_RS23720 calcium-binding protein
Query= metacyc::MONOMER-20628 (289 letters) >FitnessBrowser__Koxy:BWI76_RS23720 Length = 292 Score = 153 bits (387), Expect = 4e-42 Identities = 102/280 (36%), Positives = 144/280 (51%), Gaps = 13/280 (4%) Query: 4 QVTCVWDLKATLGEGPIW--HGDTLWFVDIKQRKIHNYHPATGERFSFDAPDQVTFLAPI 61 ++ + DLK LGE P+W LW+VD ++ + G S+D ++ A Sbjct: 2 RIEVLLDLKTRLGESPVWDIEQQRLWWVDSLDGRLFACNAQGGAIKSWDVRQKIGSFALR 61 Query: 62 VGATGFVVGLKTGIHRFHPATGFSLLLEVEDAALN-NRPNDATVDAQGRLWFGTMHDGEE 120 G VV L+ G+H A+G LL +A NR ND VD QGR FG+M EE Sbjct: 62 QNGEGAVVALQNGVHLLDFASGGLTLLHHPEADRPFNRLNDGKVDRQGRFLFGSMDMREE 121 Query: 121 NNSGSLYRMDLT-GVARMDRDICITNGPCVSPDGKTFYHTDTLEKTIYAFDL-AEDGLLS 178 SG+LYR+D + + ++I ++N PC SP G+TFY DT I A+D G LS Sbjct: 122 EPSGALYRLDADLSLHVLKKNIIVSNAPCWSPSGETFYFADTWTGEICAWDYNTATGDLS 181 Query: 179 NKRVFVQFALGDDVYPDGSVVDSEGYLWTALWGGFGAVRFSPQGDAVTRIELPAPNVTKP 238 +RVF + DG+ VDSEGYLW AL VR++P+G+ IE+P VT Sbjct: 182 GERVFCHVDRSEGGAADGATVDSEGYLWNALVYAGKLVRYTPEGEVDRIIEMPVKKVTSV 241 Query: 239 CFGGPDLKTLYFTTARKGLSDETLAQYP----LAGGVFAV 274 FGG +L LY T+ ++ L ++P L G +FA+ Sbjct: 242 MFGGENLDVLYVTS----MAQPPLPRFPEDNQLRGSLFAI 277 Lambda K H 0.321 0.139 0.442 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 300 Number of extensions: 23 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 289 Length of database: 292 Length adjustment: 26 Effective length of query: 263 Effective length of database: 266 Effective search space: 69958 Effective search space used: 69958 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory