Align Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized)
to candidate BWI76_RS07650 BWI76_RS07650 ABC transporter permease
Query= TCDB::G4FGN4 (313 letters) >FitnessBrowser__Koxy:BWI76_RS07650 Length = 351 Score = 205 bits (522), Expect = 1e-57 Identities = 120/322 (37%), Positives = 183/322 (56%), Gaps = 21/322 (6%) Query: 5 LFKAREAGIFLILIAIVVFLGVTTREFLTVENIFTVILNVSFIAIMSFGMTMVIITSGID 64 L KAR F+ L+ ++ F V FLT N+ + +V+ +++ GMT+VI+T GID Sbjct: 11 LLKART---FIALLLVIAFFSVMVPNFLTTSNLLIMTQHVAITGLLAIGMTLVILTGGID 67 Query: 65 LSVGSILGAASVVMGLLMDEKGLSPFLSVVIGLAV----------GVGFGLANGLLITKA 114 LSVG++ G +V G L+ GL + VI V GV G NG +IT+ Sbjct: 68 LSVGAVAGICGMVAGALLTN-GLPLWNGSVIFFNVPEVILCVALFGVLVGFVNGAVITRF 126 Query: 115 RLAPFISTLGMLSVGRGLAYVMSGG--WPISPFPESFTVHGQGMVGPVPVPVIYMAVIGV 172 +APFI TLGM+ V RG A + + G +P E+ G +G + IY+ + + Sbjct: 127 GVAPFICTLGMMYVARGSALLFNDGSTYPNLNGMEALGNTGFSTLGSGTLMGIYLPIWLM 186 Query: 173 IAHIFLKYTVT-----GRRIYAIGGNMEASKLVGIKTDRILILVYTINGFLAAFAGFLLT 227 I + L Y +T GR IYAIGGN A++L G+ + I VY +G +AF G ++ Sbjct: 187 IGFLLLGYWLTTKTPLGRYIYAIGGNESAARLAGVPIVKAKIFVYAFSGLCSAFVGLIVA 246 Query: 228 AWLGVAQPNAGQGYELDVIAATVIGGTSLSGGEGTILGAFLGAVIMGVLRNGMILLGVSS 287 + L A P G +E+D I ATV+GGT+L+GG G + G+ +GA ++ L +GM+++GVS Sbjct: 247 SQLQTAHPMTGNMFEMDAIGATVLGGTALAGGRGRVTGSIIGAFVIVFLADGMVMMGVSD 306 Query: 288 FWQQVVIGIVIIIAIAIDQIRR 309 FWQ V+ G+VI+ A+ +DQ ++ Sbjct: 307 FWQMVIKGVVIVTAVVVDQFQQ 328 Lambda K H 0.328 0.145 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 307 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 313 Length of database: 351 Length adjustment: 28 Effective length of query: 285 Effective length of database: 323 Effective search space: 92055 Effective search space used: 92055 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory