GapMind for catabolism of small carbon sources

 

Aligments for a candidate for xylT in Klebsiella michiganensis M5al

Align D-xylose-proton symporter (characterized)
to candidate BWI76_RS21205 BWI76_RS21205 MFS transporter

Query= CharProtDB::CH_109760
         (491 letters)



>lcl|FitnessBrowser__Koxy:BWI76_RS21205 BWI76_RS21205 MFS
           transporter
          Length = 478

 Score =  323 bits (827), Expect = 1e-92
 Identities = 183/485 (37%), Positives = 281/485 (57%), Gaps = 43/485 (8%)

Query: 3   TQYNSSYIFSITLVATLGGLLFGYDTAVISGTVESLNTVFVAPQNLSESAANSLLGFCVA 62
           T     Y+++I LVA  GGLLFGYD  VI G        F    ++++ A +   G+ ++
Sbjct: 6   THLKMGYVWTICLVAACGGLLFGYDWVVIGGAKPFYEAWF----SITDPAQS---GWAMS 58

Query: 63  SALIGCIIGGALGGYCSNRFGRRDSLKIAAVLFFISGVGSAWPELGFTSINPDNTVPVYL 122
           SAL+GC+ G  + G+C+++ GR+  L ++AVLF  S  G+A                  +
Sbjct: 59  SALVGCVFGALISGWCADKLGRKLPLILSAVLFSASAWGTA------------------V 100

Query: 123 AGYVPEFVIYRIIGGIGVGLASMLSPMYIAELAPAHIRGKLVSFNQFAIIFGQLLVYCVN 182
           A     FV+YRI+GG+G+GLAS LSP+YIAE++PA  RG+ V+ NQ  I+ G L    +N
Sbjct: 101 ASSFDMFVVYRIVGGVGIGLASALSPLYIAEVSPAEKRGRFVAVNQLTIVIGVLAAQLIN 160

Query: 183 YFIARSGDA---------SWLNTDGWRYMFASECIPALLFLMLLYTVPESPRWLMSRGKQ 233
             IA              +W    GWR+MF +E +PAL FL+L++ VPESPRWLM  GK 
Sbjct: 161 LMIAEPVATGATQQMIVETWNGQMGWRWMFGAELVPALAFLVLMFFVPESPRWLMKAGKP 220

Query: 234 EQAEGILRKIMGNTLATQAVQEIKHSL--DHGRKTGGRLLMFGVG-VIVIGVMLSIFQQF 290
           E+A   L +I     A + +++I H+L  D+ + + G LL   V  +++IG++L++FQQ+
Sbjct: 221 ERARAALERIGSADYADRILRDIAHTLEKDNHKVSYGALLAPQVKPIVIIGMVLAVFQQW 280

Query: 291 VGINVVLYYAPEVFKTLGASTDIALLQTIIVGVINLTFTVLAIMTVDKFGRKPLQIIGAL 350
            GINV+  YA E+F + G   +  L   +  GV+NL FT+ A+  VDK GR+ L ++GA 
Sbjct: 281 CGINVIFNYAQEIFASAGFDINSTLKSIVATGVVNLVFTLAALPLVDKIGRRKLMLLGAS 340

Query: 351 GMAIGMFSLGTAFYTQAPGIVALLSMLFYVAAFAMSWGPVCWVLLSEIFPNAIRGKALAI 410
           G+ +    +  A+     G   LL +L  +A +A++  PV WVLL+EIFPN +RG A+++
Sbjct: 341 GLTLIYVLIAGAYAMGIMGWPVLLLVLAAIAIYALTLAPVTWVLLAEIFPNRVRGLAMSL 400

Query: 411 AVAAQWLANYFVSWTFPMMDKNSWLVAHFHNGFSYWIYGCMGVLAALFMWKFVPETKGKT 470
              A W+A + +++TFP+++      A      S+ +YG +     L++ + VPETKG T
Sbjct: 401 GTLALWIACFLLTYTFPLLN------AGLGAAGSFLLYGVICAAGYLYILRNVPETKGVT 454

Query: 471 LEELE 475
           LE LE
Sbjct: 455 LEALE 459


Lambda     K      H
   0.326    0.140    0.433 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 621
Number of extensions: 28
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 491
Length of database: 478
Length adjustment: 34
Effective length of query: 457
Effective length of database: 444
Effective search space:   202908
Effective search space used:   202908
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory