Align D-xylose reductase (EC 1.1.1.307) (characterized)
to candidate BWI76_RS05410 BWI76_RS05410 2,5-didehydrogluconate reductase B
Query= BRENDA::I7HD84 (322 letters) >FitnessBrowser__Koxy:BWI76_RS05410 Length = 267 Score = 143 bits (361), Expect = 4e-39 Identities = 100/302 (33%), Positives = 146/302 (48%), Gaps = 51/302 (16%) Query: 16 MPLVGFGCWKVSPEDAEATIYNAIKSGYRLIDGAADYGNEVEVGRGINKAIKEGIVTREE 75 +P+ G G +++ + ++ A++ GYR ID A Y NE VG+ AI E V R E Sbjct: 3 IPVFGLGTFRLKDDVVITSVKTALELGYRTIDTAQIYDNEAAVGQ----AIAESGVARNE 58 Query: 76 VFVVTKLWNTYHNKDRLRGAFDKQLKDLGLDYVDLYLIHFPVPLKYVDIDQAYPAGWYQP 135 +F+ TK+W NK++L + + L+ L DYVDL LIH+P P V +++ Sbjct: 59 LFITTKIWIENLNKEKLIASLKESLQKLRTDYVDLTLIHWPSPNDAVAVEEF-------- 110 Query: 136 NKTEIEFEPSPMHECWREMEKLVENK---LARNIGISNFNVQLILDLLTYAKIKP-AVLQ 191 M L+E K L R IGISNF + L+ + + A Q Sbjct: 111 ------------------MAALLEAKKQGLTRQIGISNFTIPLMERAIAAVGAENIATNQ 152 Query: 192 VELHPYLQQSRMVAWVQSQGIHITAYS--SFGPASFVDLTTDGKTAAPLLEHSTIKEIAN 249 +EL PYLQ ++V W + GIHIT+Y ++G A L+ I IA Sbjct: 153 IELSPYLQNRKVVNWAREHGIHITSYMTLAYGKA---------------LKDEAIARIAA 197 Query: 250 KHNKTTGQVLLRWSTERNIAVIPKSTNQDRIKSNLDIFSWSLDKEDMDKIASLDKGLRFN 309 K++ T QV+L W+ AVIP ST ++ + SNL LD++D IA+LD R Sbjct: 198 KYDATPAQVILAWAMGEGYAVIPSSTKRENLASNLKAQDLQLDEDDRQAIAALDCNDRLV 257 Query: 310 DP 311 P Sbjct: 258 SP 259 Lambda K H 0.318 0.135 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 212 Number of extensions: 10 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 322 Length of database: 267 Length adjustment: 26 Effective length of query: 296 Effective length of database: 241 Effective search space: 71336 Effective search space used: 71336 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory