Align D-xylose reductase (EC 1.1.1.307) (characterized)
to candidate BWI76_RS09015 BWI76_RS09015 aldo/keto reductase
Query= BRENDA::F2YCN5 (340 letters) >FitnessBrowser__Koxy:BWI76_RS09015 Length = 346 Score = 129 bits (325), Expect = 8e-35 Identities = 99/315 (31%), Positives = 160/315 (50%), Gaps = 23/315 (7%) Query: 24 TRVALGTWAIGG--WMWGGTDDDASIKT---IHRAIDLGINIIDTAPAYGRGHAEEVVGK 78 + + LGT GG +WG + + A+D GIN IDTA Y G +EE+ G+ Sbjct: 14 SELCLGTMTFGGEGGLWGKVGQLRQAEAEQLVGSALDAGINFIDTANVYSEGRSEEITGQ 73 Query: 79 AIKG---QRDNLIIATKVGLDWTLTPDQSMRRNSSASRIKKEIEDSLRRLGTDYIDLYQV 135 A+K R+N+++ATKV + S R SS I +++SLRRL D+IDLYQ+ Sbjct: 74 ALKNLKVPRENVVVATKVFGETGTAGVNS--RGSSRYHIIGSVKESLRRLQLDHIDLYQL 131 Query: 136 HWPDPLVPIEETATILEALRKEGKIRSIGVSNYSVQQ------MDEFKKYAELAVSQSPY 189 H DP PIEET L+ L + G +R IGVSN++ Q + E A A Q+ Y Sbjct: 132 HGFDPATPIEETLYALDNLVQHGHVRYIGVSNWAAWQIVKALGISERLGLARFASLQAYY 191 Query: 190 NLFEREIDKDILPYAKKNDLVVLGYGALCRGLLSGRMTAD-RAFTGDDLRKTD-PKFQKP 247 + R++++++ P + L ++ + L GLLSG+ D ++ +G ++ D P K Sbjct: 192 TIAGRDLERELAPMMQSEGLGLMVWSPLAGGLLSGKYDRDGQSASGGRRQEFDFPPVNKA 251 Query: 248 RFEHYLAAVEELKKLAKEHYNKSVLALAIRWMLEQ-GPTLALWGACKPEQIDGIDEVFGW 306 R + + E+ + SV +A+ W+L Q + + GA + EQ+ Sbjct: 252 RAFDCIDVMREI----ADAKGVSVAQIALAWLLHQPAVSSVIIGAKRAEQLAENLAATSI 307 Query: 307 QISDEDLKQIDAILA 321 +S ++L ++DA+ A Sbjct: 308 VLSGDELARLDAVSA 322 Lambda K H 0.317 0.136 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 279 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 340 Length of database: 346 Length adjustment: 29 Effective length of query: 311 Effective length of database: 317 Effective search space: 98587 Effective search space used: 98587 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory