Align Putative phosphotransferase enzyme IIA component YpqE (characterized, see rationale)
to candidate 201386 SO2236 PTS system, glucose-specific IIA component (NCBI ptt file)
Query= uniprot:P50829 (168 letters) >FitnessBrowser__MR1:201386 Length = 169 Score = 124 bits (311), Expect = 8e-34 Identities = 55/148 (37%), Positives = 97/148 (65%), Gaps = 1/148 (0%) Query: 19 VIYSPADGTVMDLSDVPDPVFSQKMMGEGIAVEPSSGEIVSPAEGEVIQIFHTKHAVGIR 78 ++Y+P +G ++ + VPD VF++K++G+GIA+ P+ IV+P +G + +IF T HA I Sbjct: 22 MVYAPVNGEIVAIEKVPDVVFAEKIVGDGIAIAPTGSTIVAPIDGTIGKIFETNHAFSIE 81 Query: 79 TRSGIELLIHVGLETVNMNGEGFTAHIKEGDKVKVGDPLITCDLELIKEKASSTVIPIVI 138 + G+EL +H G+ TV + G GF+ +EG +VKVGDP+++ DLE +K++ S + P+V+ Sbjct: 82 SPQGLELFVHFGVGTVELRGRGFSRLAEEGQEVKVGDPILSFDLEYLKDQVDSLLTPVVL 141 Query: 139 MNGEAVGSMVSAGEKAARKGESKLFTIK 166 N E V + + + G+ +FT++ Sbjct: 142 ANMEDV-KYLDKAQGSVTAGKDPIFTVQ 168 Lambda K H 0.314 0.134 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 111 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 168 Length of database: 169 Length adjustment: 18 Effective length of query: 150 Effective length of database: 151 Effective search space: 22650 Effective search space used: 22650 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 43 (21.2 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory