Align neutral amino acid transporter B(0) (characterized)
to candidate 200106 SO0922 proton/glutamate symporter (NCBI ptt file)
Query= CharProtDB::CH_091706 (553 letters) >FitnessBrowser__MR1:200106 Length = 424 Score = 223 bits (568), Expect = 1e-62 Identities = 144/449 (32%), Positives = 228/449 (50%), Gaps = 58/449 (12%) Query: 65 VGLGLGVSAAGGADALGPARLTRFAFPGELLLRLLKMIILPLVVCSLIGGAASLDPSA-L 123 +G+ +GV+ A L P G L + +KM+I+PLV CSLI G S++ +A + Sbjct: 15 LGILVGVTLGEQASYLKPI--------GTLFVNTIKMLIVPLVFCSLIVGVTSMEDTAKM 66 Query: 124 GRVGAWALLFFLVTTLLASALGVGLALALKPGAAVTAITSINDSVVDPCARSAPTKEALD 183 GR+G + F+L TT +A +LG+ + ++PGA V + + T + + Sbjct: 67 GRIGFKSFSFYLCTTAIAISLGLVVGYVIQPGAGVPLLQH----------EAVNTAKEVP 116 Query: 184 SFLDLVRNIFPSNLVSAAFRSFATSYEPKDNSCKIPQSCIQREINSTMVQLLCEVEGMNI 243 S + + +I P+N V+A + I Sbjct: 117 SVMQTLIDIVPTNPVAA-------------------------------------LASGQI 139 Query: 244 LGLVVFAIVFGVALRKLGPEGELLIRFFNSFNDATMVLVSWIMWYAPVGILFLVASKIVE 303 L ++VFA+ G+AL +G G+ I+ F S +A L +M AP G+ L+A E Sbjct: 140 LQVIVFAVALGIALVLIGDHGKPAIKVFESLAEAMYKLTDMVMKLAPYGVFGLMAWVAGE 199 Query: 304 MKDVRQLFISLGKYILCCLLGHAIHGLLVLPLIYFLFTRKNPYRFLWGIMTPLATAFGTS 363 + L K I+ +G IH L ++ LF + NP F GI +A AF TS Sbjct: 200 YGI--DMLWPLIKVIIAVYIGCIIHVLGFYSIVLRLFAKLNPLHFFKGISNAMAVAFTTS 257 Query: 364 SSSATLPLMMKCVEEKNGVAKHISRFILPIGATVNMDGAALFQCVAAVFIAQLNGVSLDF 423 SS+ TLP MKC E GV K IS F+LP+G T+NMDG AL+Q V A+F+AQ G+ L + Sbjct: 258 SSAGTLPASMKCASEYLGVNKKISSFVLPLGTTINMDGTALYQGVTALFVAQAFGIDLTW 317 Query: 424 VKIITILVTATASSVGAAGIPAGGVLTLAIILEAVSLPVKDISLILAVDWLVDRSCTVLN 483 V +TI++TAT +S+G AG+P G++ L ++L V LP++ ++LI +D ++D + TV+N Sbjct: 318 VDYLTIILTATLASIGTAGVPGAGLVMLTLVLSTVGLPLEGVALIAGIDRILDMARTVVN 377 Query: 484 VEGDAFGAGLLQSYVDRTKMPSSEPELIQ 512 V GD ++ + + +++Q Sbjct: 378 VSGDLVATTVIAKSENELDVEHYNADMVQ 406 Lambda K H 0.323 0.138 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 419 Number of extensions: 23 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 553 Length of database: 424 Length adjustment: 34 Effective length of query: 519 Effective length of database: 390 Effective search space: 202410 Effective search space used: 202410 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory