Align Transporter, component of The methionine/alanine uptake porter, MetPS (Trotschel et al., 2008) (MetP is the transporter; MetS is an essential auxiliary subunit) (characterized)
to candidate 203417 SO4339 sodium-dependent transporter, putative (NCBI ptt file)
Query= TCDB::Q8NRL8 (579 letters) >FitnessBrowser__MR1:203417 Length = 454 Score = 182 bits (462), Expect = 3e-50 Identities = 139/440 (31%), Positives = 210/440 (47%), Gaps = 34/440 (7%) Query: 37 FSSRSVFILAAIGSAVGLGNIWRFPYVAYDNGGGAFLIPYAIALLTAGIPLLFLDFAIGH 96 FSSR FI+AA GSAVG+GNIW FP A +GGGAFL+ Y + + GIP+L + IG Sbjct: 12 FSSRLGFIMAAAGSAVGVGNIWGFPTQAATHGGGAFLLVYLVLIFILGIPMLMAELMIGR 71 Query: 97 RYRGSAPLAFRRF------KKQTETIGWIQVGIAFFITIYYAAIIGWAGLYAFKSLNKAW 150 + + A + + +TIG I + A I +Y+ + GW +A + A+ Sbjct: 72 HGQTNPADAMGKLGCNSLTRSLGKTIGLISIVTAGLIYTFYSILSGWFVSFAIAPIATAF 131 Query: 151 GADPDTYFFSDFLNFDSEAVVSMDIVPQIAIALFIVWIAAIVVLAIGVDKGIGRVSMVFM 210 G++ + DF +S ++V + + + +VL GV +GI + S M Sbjct: 132 GSNDTAAWLMDFS-------LSRNLVFTLIFSTLV-----FLVLLQGVQEGIEKWSKRLM 179 Query: 211 PLLVIIFLIVVIQAVLLPGAEIGLDALFTPNWEALKNPTVWIAAYGQIFFSLSVGFGIML 270 PLL+I+ + V L GA G+ AL TPN+ P I A GQ FFSL++G G M+ Sbjct: 180 PLLLIMLIAGVAYIFSLNGASEGISALLTPNFAKAIAPDTLINALGQTFFSLTIGTGAMM 239 Query: 271 TYSSYLKPRTNLTSTGLVTGFANSSFEVLAGIGVFAALGFMAANAGVGV---DEVATSGI 327 Y SYL + N+ + F +S LA + A+ ++A + GV + + Sbjct: 240 VYGSYLSQKENIAKLTVWVAFTDSGIAFLAAFLIIPAM-YVAQHNGVQIFSPEGKLIDSD 298 Query: 328 GLAFVAFPAIINEM--PLGGLFGFLFFSSLTIAGFTSLFSLLEVVVSAVKDKFGLNRKAT 385 L F PA+ + + + +FF L IAG TS S+ EV S V K G +R+ Sbjct: 299 ALVFTVLPALFSTLGDTANLIISVVFFMLLIIAGLTSAISIAEVPTSYVMQKCGFSRQRA 358 Query: 386 AIGVGVVMALLSLGLFSTTSGLATLDIMDKFTNNIGIVAVALIAVVSIDWVLRRIDEFST 445 + +G+++ LSL L L + IM T + VAL + + W+ R+ S Sbjct: 359 TLIIGLLLTALSLLLAVFFETLFSFTIM--LTTQMTQPLVALGIAIYLGWIWRQ----SQ 412 Query: 446 HLNAISAFK----VNTIWRI 461 L AIS + WRI Sbjct: 413 LLKAISKQEGVDATGLFWRI 432 Lambda K H 0.325 0.141 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 571 Number of extensions: 38 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 579 Length of database: 454 Length adjustment: 35 Effective length of query: 544 Effective length of database: 419 Effective search space: 227936 Effective search space used: 227936 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory