Align L-arabinose 1-dehydrogenase (EC 1.1.1.46) (characterized)
to candidate 202371 SO3263 3-oxoacyl-(acyl-carrier-protein) reductase, putative (NCBI ptt file)
Query= reanno::ANA3:7024897 (256 letters) >FitnessBrowser__MR1:202371 Length = 255 Score = 113 bits (283), Expect = 3e-30 Identities = 84/246 (34%), Positives = 123/246 (50%), Gaps = 12/246 (4%) Query: 13 KTIFISGGATGIGACLVNAFLEQGAKVAFVDILVEESTQLVADLKQTQPEASVTFYHCDL 72 K + I+GG+ GIGA + AF E G VA + ++ +A++ + V + D Sbjct: 14 KLVLITGGSRGIGAGIAKAFAEAGYWVAITYLNHQDKAVSLANILGDK----VAAFALDQ 69 Query: 73 VDIAALKRVIAQVEDDLG-PISVLINNAACDQRHSIDEVTPEYWDQCLNTNLRHYFFAVQ 131 ++K+ I +VE I VLINN A Q ++T + + LNTNLR F Q Sbjct: 70 SKPESIKQCITEVEKYFNRSIDVLINNGAIAQEKPFSDITADDFTTMLNTNLRGPFLLAQ 129 Query: 132 AVRPQMQRLGGGSVINLGSMSWHNRQAGMAGYTASKAGAMGLTRGLAADLGKDKIRINTL 191 A P MQ+ G G +IN+GS+ Y A+KAG + L++ +A +D IR NT+ Sbjct: 130 ACIPAMQQHGFGRIINIGSIGGQWGGYNQVHYAAAKAGLINLSQSIAKIYSRDGIRTNTI 189 Query: 192 TPGWV---MTKRQLTHWVDKDTAKHIENNQCIKEYVMPEDIAAMALFLAADDSKLCTAQN 248 G V MT+ +LT K A I + K EDIA++ALFLA+ DS + Q Sbjct: 190 AIGLVATEMTEHELTTEAGKQKAAAIPVGRLGK----VEDIASIALFLASQDSDYLSGQT 245 Query: 249 FIVDGG 254 +GG Sbjct: 246 LNANGG 251 Lambda K H 0.320 0.134 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 170 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 255 Length adjustment: 24 Effective length of query: 232 Effective length of database: 231 Effective search space: 53592 Effective search space used: 53592 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory