Align Succinylornithine transaminase (EC 2.6.1.81) (characterized)
to candidate 199805 SO0617 acetylornithine aminotransferase (NCBI ptt file)
Query= reanno::pseudo1_N1B4:Pf1N1B4_3440 (406 letters) >FitnessBrowser__MR1:199805 Length = 405 Score = 537 bits (1384), Expect = e-157 Identities = 265/406 (65%), Positives = 325/406 (80%), Gaps = 1/406 (0%) Query: 1 MSVEHAAVERADFDQVMVPNYAPAAFIPVRGAGSRVWDQSGRELIDFAGGIAVNVLGHAH 60 MSV+ + RA FD VMVPNYAPAA IPVRG GSRVWDQ G E IDFAGGIAVN LGH H Sbjct: 1 MSVD-MKLNRAQFDAVMVPNYAPAAVIPVRGEGSRVWDQEGNEFIDFAGGIAVNCLGHCH 59 Query: 61 PALVAALTEQANKLWHVSNVFTNEPALRLAHKLVDATFAERVFFCNSGAEANEAAFKLAR 120 PALV AL Q KLWH+SNV TNEPAL LA KLV++TFAERV+F NSGAEANEAA KLAR Sbjct: 60 PALVNALKTQGEKLWHLSNVMTNEPALELATKLVNSTFAERVYFANSGAEANEAALKLAR 119 Query: 121 RVAHDRFGTEKYEIVAALNSFHGRTLFTVNVGGQSKYSDGFGPKITGITHVPYNDLAALK 180 R A ++ G EK EI+A +FHGRT FTV+VGGQ+ YSDGFGPK ITH+P+ND+AAL+ Sbjct: 120 RYALEKHGVEKDEIIAFDKAFHGRTFFTVSVGGQAAYSDGFGPKPQSITHLPFNDVAALE 179 Query: 181 AAVSDKTCAVVLEPIQGEGGVLPAELSYLQGARELCDAHNALLVFDEVQTGMGRSGKLFA 240 AAVSDKTCA++LEP+QGEGG++ A+ ++L+ REL + HNAL++FDEVQTG+GR+G+L+A Sbjct: 180 AAVSDKTCAIMLEPLQGEGGIIDADPAFLKAVRELANKHNALVIFDEVQTGVGRTGELYA 239 Query: 241 YQHYGVTPDILTSAKSLGGGFPIAAMLTTEDLAKHLVVGTHGTTYGGNPLACAVAEAVID 300 Y + PDILT+AK+LGGGFPIAAMLTT ++A+HL VGTHG+TYGGNPLACA+ AV+D Sbjct: 240 YMGTDIVPDILTTAKALGGGFPIAAMLTTTEIAEHLKVGTHGSTYGGNPLACAIGNAVLD 299 Query: 301 VINTPEVLNGVNAKHDKFKTRLEQIGEKYGLFTEVRGLGLLLGCVLSDAWKGKAKDIFNA 360 V+NTPEVLNGV + + L +I EKY +F+EVRG GLLLG VL++ ++G+++D A Sbjct: 300 VVNTPEVLNGVKHREQLLRDGLNKINEKYHVFSEVRGKGLLLGAVLNEQYQGRSRDFLVA 359 Query: 361 AEREGLMILQAGPDVIRFAPSLVVEDADIDAGLDRFERAAAKLTQA 406 + EGLM L AG +V+RFAPSLV+ +ADI GL RFERA A + A Sbjct: 360 SVAEGLMSLMAGANVVRFAPSLVIPEADIAEGLARFERAVASIAAA 405 Lambda K H 0.320 0.136 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 513 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 405 Length adjustment: 31 Effective length of query: 375 Effective length of database: 374 Effective search space: 140250 Effective search space used: 140250 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
Align candidate 199805 SO0617 (acetylornithine aminotransferase (NCBI ptt file))
to HMM TIGR03246 (astC: succinylornithine transaminase family (EC 2.6.1.81))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03246.hmm # target sequence database: /tmp/gapView.25687.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03246 [M=397] Accession: TIGR03246 Description: arg_catab_astC: succinylornithine transaminase family Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.2e-213 693.2 1.2 5.9e-213 693.0 1.2 1.0 1 lcl|FitnessBrowser__MR1:199805 SO0617 acetylornithine aminotran Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__MR1:199805 SO0617 acetylornithine aminotransferase (NCBI ptt file) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 693.0 1.2 5.9e-213 5.9e-213 2 396 .. 8 402 .. 7 403 .. 0.99 Alignments for each domain: == domain 1 score: 693.0 bits; conditional E-value: 5.9e-213 TIGR03246 2 eresfdevmvpvyapakfipvrgeGsrvwdqegkeyidfaGGiavnalGhahpelvealkeqaeklwhlgngytnepvl 80 +r++fd vmvp+yapa++ipvrgeGsrvwdqeg+e+idfaGGiavn+lGh+hp+lv+alk q+eklwhl+n++tnep+l lcl|FitnessBrowser__MR1:199805 8 NRAQFDAVMVPNYAPAAVIPVRGEGSRVWDQEGNEFIDFAGGIAVNCLGHCHPALVNALKTQGEKLWHLSNVMTNEPAL 86 89***************************************************************************** PP TIGR03246 81 rlakklvdatfadkvffcnsGaeaneaalklarkvaldkygaekseivafknsfhGrtlftvsvGGqakysedfaplpe 159 +la klv++tfa++v+f+nsGaeaneaalklar++al+k+g ek+ei+af ++fhGrt+ftvsvGGqa+ys++f+p+p+ lcl|FitnessBrowser__MR1:199805 87 ELATKLVNSTFAERVYFANSGAEANEAALKLARRYALEKHGVEKDEIIAFDKAFHGRTFFTVSVGGQAAYSDGFGPKPQ 165 ******************************************************************************* PP TIGR03246 160 gikhaayndlealkalisdktcavivepiqGegGvvpadkaflkglrelcdrhnallifdevqtGvGrtGelyaymeyG 238 i+h+++nd++al+a++sdktca+++ep+qGegG++ ad+aflk++rel ++hnal+ifdevqtGvGrtGelyaym + lcl|FitnessBrowser__MR1:199805 166 SITHLPFNDVAALEAAVSDKTCAIMLEPLQGEGGIIDADPAFLKAVRELANKHNALVIFDEVQTGVGRTGELYAYMGTD 244 ******************************************************************************* PP TIGR03246 239 vtpdiltsakalGgGfpiGalltteelakvlkvGthGttyGGnplacavaekvldlvntaelleGvkqrhelfvdelek 317 ++pdilt+akalGgGfpi a+ltt+e+a++lkvGthG+tyGGnplaca+ ++vld+vnt+e+l+Gvk+r++l+ d l+k lcl|FitnessBrowser__MR1:199805 245 IVPDILTTAKALGGGFPIAAMLTTTEIAEHLKVGTHGSTYGGNPLACAIGNAVLDVVNTPEVLNGVKHREQLLRDGLNK 323 ******************************************************************************* PP TIGR03246 318 inarykvfseirGkGlliGavlteeyaGkakdlvnaaaeeGvlvliaGpdvvrfapslvieeeeikeGlarlekavekl 396 in++y+vfse+rGkGll+Gavl+e+y+G+++d++ a+ +eG++ l+aG++vvrfapslvi+e++i+eGlar+e+av+++ lcl|FitnessBrowser__MR1:199805 324 INEKYHVFSEVRGKGLLLGAVLNEQYQGRSRDFLVASVAEGLMSLMAGANVVRFAPSLVIPEADIAEGLARFERAVASI 402 ****************************************************************************976 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (397 nodes) Target sequences: 1 (405 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.01 # Mc/sec: 9.02 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory