Align 5-aminovalerate transaminase (EC 2.6.1.48) (characterized)
to candidate 200475 SO1300 glutamate-1-semialdehyde-2,1-aminomutase (NCBI ptt file)
Query= BRENDA::Q9I6M4 (426 letters) >FitnessBrowser__MR1:200475 Length = 430 Score = 167 bits (424), Expect = 4e-46 Identities = 120/367 (32%), Positives = 182/367 (49%), Gaps = 32/367 (8%) Query: 5 NESLLKRRQAAVPRGVGQI---------HPVVAERAENSTVWDVEGREYIDFAGGIAVLN 55 +E+L ++ + +P GV P+ E+A+ + ++D +G+ YID+ G + Sbjct: 4 SEALFEQAKKTIPGGVNSPVRAFNGVGGSPLFIEKADGAYIYDADGKAYIDYVGSWGPMI 63 Query: 56 TGHLHPK----VIAAVQEQLGKLSHTCFQVLAYEPYIELAEEIAKRVPGDFPKKTLLVTS 111 GH HPK V+AAV L + T E +++AE++ VP ++ +V+S Sbjct: 64 LGHNHPKIREAVLAAVHNGLSFGAPT-------ELEVQMAEKVIAMVPSI--EQVRMVSS 114 Query: 112 GSEAVENAVKIARAATGRAGVIAFTGAYHGRTMMTLGLTGKVVPYSAGMGLMPGGIFRAL 171 G+EA +A+++AR T R ++ F G YHG L G + G PG I Sbjct: 115 GTEATMSAIRLARGFTNRDKILKFEGCYHGHADCLLVKAGSGA-LTLGQPSSPG-IPEDF 172 Query: 172 APCELHGVSEDDSIASIERIFKNDAQPQDIAAIIIEPVQGEGGFYVNSKSFMQRLRALCD 231 A L V D + S+ +F+ P +I+ IIIEPV G F++ LR+LCD Sbjct: 173 AKHTLTAVYND--LDSVRSLFEQ--YPTEISCIIIEPVAGNMNCIPPIPGFLEGLRSLCD 228 Query: 232 QHGILLIADEVQTGAGRTGTFFATEQLGIVPDLTTFAKSVGGGFPISGVAGKAEIMDAIA 291 + G LLI DEV TG R A G+ PDLTT K +GGG P+ G+ ++M IA Sbjct: 229 EFGALLIIDEVMTGF-RVSKSGAQGHYGVTPDLTTLGKVIGGGMPVGAFGGRKDVMQFIA 287 Query: 292 PGG---LGGTYAGSPIACAAALAVLKVFEEEKLLERSQAVGERLKAGLREIQAKHKVIGD 348 P G GT +G+PIA +A LA ++ EE L E A +R+ G + KH + Sbjct: 288 PTGPVYQAGTLSGNPIAMSAGLAQMEALCEEGLYEALSAKTKRIAEGFKAAADKHGIPMA 347 Query: 349 VRGLGSM 355 + +G M Sbjct: 348 INYVGGM 354 Lambda K H 0.319 0.137 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 452 Number of extensions: 27 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 426 Length of database: 430 Length adjustment: 32 Effective length of query: 394 Effective length of database: 398 Effective search space: 156812 Effective search space used: 156812 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory