GapMind for catabolism of small carbon sources

 

Aligments for a candidate for rocA in Shewanella oneidensis MR-1

Align L-glutamate gamma-semialdehyde dehydrogenase (EC 1.2.1.88) (characterized)
to candidate 203555 SO4480 aldehyde dehydrogenase (NCBI ptt file)

Query= BRENDA::Q72IB9
         (516 letters)



>lcl|FitnessBrowser__MR1:203555 SO4480 aldehyde dehydrogenase (NCBI
           ptt file)
          Length = 506

 Score =  216 bits (551), Expect = 1e-60
 Identities = 165/481 (34%), Positives = 241/481 (50%), Gaps = 32/481 (6%)

Query: 34  FGRHYPLYIGGEWVDTKERMVSLNPSAPS-EVVGTTAKAGKAEAEAALEAAWKAFKTWKD 92
           F   Y  +IGG+WV         N S  + +      ++   + E AL+AA  A   W  
Sbjct: 15  FKEKYANFIGGKWVAPVNGKYFDNRSPVNGQNFCKIPRSDAQDIELALDAAHAAKDAWGK 74

Query: 93  WPQEDRSRLLLKAAALMRRRKRELEATLVYEVGKNWVEA-SADVAEAIDFIEYYARAALR 151
               +RS +LL+ A  + +    L     +E GK   E  +AD+   +D   Y+A     
Sbjct: 75  TSVTERSNILLRIADRVEQNLEYLAVAETWENGKAVRETLNADLPLFVDHFRYFAGCIRA 134

Query: 152 YRYPAVEVVPYPGEDNESFYVPLGAGVV--IAPWNFPVAIFTGMIMGPVAVGNTVIAKPA 209
               A ++      +  S++ P   GVV  I PWNFP+ +    I   +A GN V+ KPA
Sbjct: 135 QEGSAADI----DGNTVSYHFPEPLGVVGQIIPWNFPLLMAAWKIAPALAAGNCVVLKPA 190

Query: 210 EDAVVVGAKVFEIFHEAGFPPGVVNFLPGVGEEVGAYLVEHPRTRFINFTGSLEVGLKIY 269
           E   V    + E+  +   PPGV+N + G G E G  L    R   + FTGS EVG  I 
Sbjct: 191 EQTPVSILVLLELIEDL-LPPGVLNVVNGFGAEAGQALATSKRIAKLAFTGSTEVGFHIL 249

Query: 270 EAAGRLAPGQTWFKRAYVETGGKD-----AIIVDETADF-DLAAEGVVVSAYGFQGQKCS 323
           + A       T      VE GGK      A ++D+  ++ D A EG++++ +  QG+ C+
Sbjct: 250 KCAAESLIPST------VELGGKSPNLYFADVMDQEDEYLDKAVEGMLLAFFN-QGEVCT 302

Query: 324 AASRLILTQGAYEPVLERVLKRAERLSVG-PAEENPDLGPVVSAEQERKVLSYIEIGKNE 382
             SR+++ +  Y+  +E+VL RA+ +  G P +    +G   S EQ  K+LSY+ IGK+E
Sbjct: 303 CPSRVLIQESIYDRFIEKVLARAQTIKQGNPLDTATQVGAQASQEQFDKILSYLAIGKDE 362

Query: 383 G-QLVLGGK--RLEGE---GYFIAPTVFTEVPPKARIAQEEIFGPVLSVIRVKDFAEALE 436
           G Q++LGG   +LEGE   GY+I+PT+  +   K RI QEEIFGPV+SV   KD AEAL 
Sbjct: 363 GAQVLLGGSLCQLEGEQSKGYYISPTIM-KGHNKMRIFQEEIFGPVISVTTFKDEAEALA 421

Query: 437 VANDTPYGLTGGVYSRKREHLEWARREFHVGNLYFNRKITGALVGVQPFGGFKLSGTNAK 496
           +ANDT YGL  GV++R     +   R    G ++ N     A      FGG+K SG   +
Sbjct: 422 IANDTEYGLGAGVWTRDMNRAQRMGRGIQAGRVWIN--CYHAYPAHAAFGGYKKSGIGRE 479

Query: 497 T 497
           T
Sbjct: 480 T 480


Lambda     K      H
   0.319    0.137    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 599
Number of extensions: 35
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 516
Length of database: 506
Length adjustment: 35
Effective length of query: 481
Effective length of database: 471
Effective search space:   226551
Effective search space used:   226551
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory