Align BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized)
to candidate 203725 SO4655 sulfate ABC transporter, ATP-binding protein (NCBI ptt file)
Query= TCDB::Q52666 (263 letters) >FitnessBrowser__MR1:203725 Length = 354 Score = 157 bits (397), Expect = 3e-43 Identities = 90/245 (36%), Positives = 144/245 (58%), Gaps = 10/245 (4%) Query: 21 IAIQISQMNKWYGQFHVLRDINLTVHRGERIVIAGPSGSGKSTMIRCINRLEEHQSGKII 80 ++I I Q+NK +G F + +NL + GE + GPSGSGK+T++R I LE+ SG + Sbjct: 1 MSIHIQQVNKHFGNFVAVDSVNLEIKTGELTALLGPSGSGKTTLLRIIAGLEQADSGIVK 60 Query: 81 VDGIELTSDLKNIDKVRSEVGMVFQHFNLFPHLTILEN----LTLAPIWVRKVPKREAEE 136 +G ++T+ + VG VFQH+ LF H+T+ EN LT+ P R K E E Sbjct: 61 FNGEDITTQHVS----ERGVGFVFQHYALFKHMTVFENVAYGLTVRPRKTRP-SKAEIAE 115 Query: 137 TAMYYLEKVKIPEQAQKYPGQLSGGQQQRVAIARSLCMKPKIMLFDEPTSALDPEMIKEV 196 L+ V++ A +YP QLSGGQ+QR+A+AR+L ++PK++L DEP ALD ++ E+ Sbjct: 116 KVHSLLKLVQLDWTADRYPSQLSGGQRQRIALARALAVEPKVLLLDEPFGALDAKVRAEL 175 Query: 197 LDTMIQLAEE-GMTMLCVTHEMGFAQAVANRVIFMADGQIVEQNNPHDFFHNPQSERTKQ 255 + +L +E +T + VTH+ A VA++++ M G+I +Q P + + P + + Sbjct: 176 RRWLRRLHDEINVTTVFVTHDQEEALEVADKIVVMNKGRIEQQGTPEEVYDTPSNPFVYE 235 Query: 256 FLSQI 260 FL + Sbjct: 236 FLGNV 240 Lambda K H 0.320 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 227 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 354 Length adjustment: 27 Effective length of query: 236 Effective length of database: 327 Effective search space: 77172 Effective search space used: 77172 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory