Align iron(III) dicitrate transport ATP-binding protein FecE (characterized)
to candidate 202770 SO_3675 hemin importer ATP-binding subunit (RefSeq)
Query= CharProtDB::CH_088321 (255 letters) >FitnessBrowser__MR1:202770 Length = 272 Score = 150 bits (380), Expect = 2e-41 Identities = 92/255 (36%), Positives = 141/255 (55%), Gaps = 10/255 (3%) Query: 3 LRTENLTVSYGTDKVLNDVSLSLPTGKITALIGPNGCGKSTLLNCFSRLLMPQSGTVFLG 62 L + L+ + G VLN++ + G +TAL+GPNG GKSTLL + + G++ LG Sbjct: 20 LTVDRLSYAIGDKAVLNNIRVQFQPGSVTALLGPNGAGKSTLLKALCQEIPSAQGSIKLG 79 Query: 63 DNPINMLSSRQLARRLSLLPQHHLTPEGITVQELVSYGRNPWLSLWGRLSAEDNARVNVA 122 + +LA+ L++LPQH TV E+V+ G P L+L E V Sbjct: 80 HCQLVDWPRAELAKSLAVLPQHASLTFPFTVDEVVAMGLYP-LTL---SQKEGQQLVTKW 135 Query: 123 MNQTRINHLAVRRLTELSGGQRQRAFLAMVLAQNT-----PVVLLDEPTTYLDINHQVDL 177 + + + HLA R LSGG++QR LA VL Q + P++LLDEPT+ LD+ Q + Sbjct: 136 LAEVGVLHLARRSYPTLSGGEKQRVQLARVLTQLSQSPFPPILLLDEPTSALDLAQQHKV 195 Query: 178 MRLMGEL-RTQGKTVVAVLHDLNQASRYCDQLVVMANGHVMAQGTPEEVMTPGLLRTVFS 236 + L L TV+ VLHDLNQA+RY D+++V+ G ++++GTP + ++ ++R V+ Sbjct: 196 LALAKNLAHKHAYTVIVVLHDLNQAARYSDRVIVLKQGEIVSEGTPNDALSIDIIRQVWD 255 Query: 237 VEAEIHPEPVSGRPM 251 E E P P P+ Sbjct: 256 YEPEFIPAPQGDYPL 270 Lambda K H 0.320 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 177 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 272 Length adjustment: 25 Effective length of query: 230 Effective length of database: 247 Effective search space: 56810 Effective search space used: 56810 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory