Align ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale)
to candidate 202699 SO3602 sulfate ABC transporter, ATP-binding protein (NCBI ptt file)
Query= uniprot:A0A1N7U8S3 (276 letters) >FitnessBrowser__MR1:202699 Length = 376 Score = 140 bits (353), Expect = 4e-38 Identities = 90/255 (35%), Positives = 151/255 (59%), Gaps = 22/255 (8%) Query: 25 IKLQVEGIHKRYGEHEVLKGVSLNARQGDVISLIGASGSGKSTMLRCINFLEQPDAGVIT 84 + +++ I K++G+ + L ++L+ ++G++I L+G SGSGK+T+LR I LE D+G I Sbjct: 1 MSIRLTNISKKFGQFQALSPLNLDIQEGEMIGLLGPSGSGKTTLLRIIAGLEGADSGHIH 60 Query: 85 LDGISIEMRQGRAGTRAPHQDQLQNLRTRLAMVFQHFNLWSHMTVLENITMA----PRRV 140 G R Q +++ R+ VFQ++ L+ HMTV +N+ P++ Sbjct: 61 F------------GNRDVTQVHVRD--RRVGFVFQNYALFRHMTVADNVAFGLEVIPKKQ 106 Query: 141 LDVSAAEAEKRARMYLDKVGLPSRVADQYPAFLSGGQQQRVAIARALAMEPEIILFDEPT 200 SAAE +KR L+ V L +A +YP LSGGQ+QR+A+ARALA +PE++L DEP Sbjct: 107 RP-SAAEIQKRVSHLLEMVQL-GHLAQRYPEQLSGGQKQRIALARALATQPEVLLLDEPF 164 Query: 201 SALDPELVGEVLKVIQTLAEEGR-TMLMVTHEMGFARQVSSQVLFLHQGRVEE-HGDARI 258 ALD ++ E+ + +++L +E + T + VTH+ A ++S +V+ + G +E+ + + Sbjct: 165 GALDAKVRKELRRWLRSLHDELKFTSVFVTHDQDEALELSDRVVVMSNGNIEQVNTPIEL 224 Query: 259 LDQPNSERLQQFLSN 273 QPNS + FL N Sbjct: 225 YAQPNSRFVFDFLGN 239 Lambda K H 0.319 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 202 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 376 Length adjustment: 28 Effective length of query: 248 Effective length of database: 348 Effective search space: 86304 Effective search space used: 86304 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory