Align Succinylornithine transaminase (EC 2.6.1.81) (characterized)
to candidate 199805 SO0617 acetylornithine aminotransferase (NCBI ptt file)
Query= reanno::pseudo1_N1B4:Pf1N1B4_3440 (406 letters) >FitnessBrowser__MR1:199805 Length = 405 Score = 537 bits (1384), Expect = e-157 Identities = 265/406 (65%), Positives = 325/406 (80%), Gaps = 1/406 (0%) Query: 1 MSVEHAAVERADFDQVMVPNYAPAAFIPVRGAGSRVWDQSGRELIDFAGGIAVNVLGHAH 60 MSV+ + RA FD VMVPNYAPAA IPVRG GSRVWDQ G E IDFAGGIAVN LGH H Sbjct: 1 MSVD-MKLNRAQFDAVMVPNYAPAAVIPVRGEGSRVWDQEGNEFIDFAGGIAVNCLGHCH 59 Query: 61 PALVAALTEQANKLWHVSNVFTNEPALRLAHKLVDATFAERVFFCNSGAEANEAAFKLAR 120 PALV AL Q KLWH+SNV TNEPAL LA KLV++TFAERV+F NSGAEANEAA KLAR Sbjct: 60 PALVNALKTQGEKLWHLSNVMTNEPALELATKLVNSTFAERVYFANSGAEANEAALKLAR 119 Query: 121 RVAHDRFGTEKYEIVAALNSFHGRTLFTVNVGGQSKYSDGFGPKITGITHVPYNDLAALK 180 R A ++ G EK EI+A +FHGRT FTV+VGGQ+ YSDGFGPK ITH+P+ND+AAL+ Sbjct: 120 RYALEKHGVEKDEIIAFDKAFHGRTFFTVSVGGQAAYSDGFGPKPQSITHLPFNDVAALE 179 Query: 181 AAVSDKTCAVVLEPIQGEGGVLPAELSYLQGARELCDAHNALLVFDEVQTGMGRSGKLFA 240 AAVSDKTCA++LEP+QGEGG++ A+ ++L+ REL + HNAL++FDEVQTG+GR+G+L+A Sbjct: 180 AAVSDKTCAIMLEPLQGEGGIIDADPAFLKAVRELANKHNALVIFDEVQTGVGRTGELYA 239 Query: 241 YQHYGVTPDILTSAKSLGGGFPIAAMLTTEDLAKHLVVGTHGTTYGGNPLACAVAEAVID 300 Y + PDILT+AK+LGGGFPIAAMLTT ++A+HL VGTHG+TYGGNPLACA+ AV+D Sbjct: 240 YMGTDIVPDILTTAKALGGGFPIAAMLTTTEIAEHLKVGTHGSTYGGNPLACAIGNAVLD 299 Query: 301 VINTPEVLNGVNAKHDKFKTRLEQIGEKYGLFTEVRGLGLLLGCVLSDAWKGKAKDIFNA 360 V+NTPEVLNGV + + L +I EKY +F+EVRG GLLLG VL++ ++G+++D A Sbjct: 300 VVNTPEVLNGVKHREQLLRDGLNKINEKYHVFSEVRGKGLLLGAVLNEQYQGRSRDFLVA 359 Query: 361 AEREGLMILQAGPDVIRFAPSLVVEDADIDAGLDRFERAAAKLTQA 406 + EGLM L AG +V+RFAPSLV+ +ADI GL RFERA A + A Sbjct: 360 SVAEGLMSLMAGANVVRFAPSLVIPEADIAEGLARFERAVASIAAA 405 Lambda K H 0.320 0.136 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 513 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 405 Length adjustment: 31 Effective length of query: 375 Effective length of database: 374 Effective search space: 140250 Effective search space used: 140250 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
Align candidate 199805 SO0617 (acetylornithine aminotransferase (NCBI ptt file))
to HMM TIGR03246 (astC: succinylornithine transaminase family (EC 2.6.1.81))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03246.hmm # target sequence database: /tmp/gapView.2179.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03246 [M=397] Accession: TIGR03246 Description: arg_catab_astC: succinylornithine transaminase family Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.2e-213 693.2 1.2 5.9e-213 693.0 1.2 1.0 1 lcl|FitnessBrowser__MR1:199805 SO0617 acetylornithine aminotran Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__MR1:199805 SO0617 acetylornithine aminotransferase (NCBI ptt file) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 693.0 1.2 5.9e-213 5.9e-213 2 396 .. 8 402 .. 7 403 .. 0.99 Alignments for each domain: == domain 1 score: 693.0 bits; conditional E-value: 5.9e-213 TIGR03246 2 eresfdevmvpvyapakfipvrgeGsrvwdqegkeyidfaGGiavnalGhahpelvealkeqaeklwhlgngytnepvl 80 +r++fd vmvp+yapa++ipvrgeGsrvwdqeg+e+idfaGGiavn+lGh+hp+lv+alk q+eklwhl+n++tnep+l lcl|FitnessBrowser__MR1:199805 8 NRAQFDAVMVPNYAPAAVIPVRGEGSRVWDQEGNEFIDFAGGIAVNCLGHCHPALVNALKTQGEKLWHLSNVMTNEPAL 86 89***************************************************************************** PP TIGR03246 81 rlakklvdatfadkvffcnsGaeaneaalklarkvaldkygaekseivafknsfhGrtlftvsvGGqakysedfaplpe 159 +la klv++tfa++v+f+nsGaeaneaalklar++al+k+g ek+ei+af ++fhGrt+ftvsvGGqa+ys++f+p+p+ lcl|FitnessBrowser__MR1:199805 87 ELATKLVNSTFAERVYFANSGAEANEAALKLARRYALEKHGVEKDEIIAFDKAFHGRTFFTVSVGGQAAYSDGFGPKPQ 165 ******************************************************************************* PP TIGR03246 160 gikhaayndlealkalisdktcavivepiqGegGvvpadkaflkglrelcdrhnallifdevqtGvGrtGelyaymeyG 238 i+h+++nd++al+a++sdktca+++ep+qGegG++ ad+aflk++rel ++hnal+ifdevqtGvGrtGelyaym + lcl|FitnessBrowser__MR1:199805 166 SITHLPFNDVAALEAAVSDKTCAIMLEPLQGEGGIIDADPAFLKAVRELANKHNALVIFDEVQTGVGRTGELYAYMGTD 244 ******************************************************************************* PP TIGR03246 239 vtpdiltsakalGgGfpiGalltteelakvlkvGthGttyGGnplacavaekvldlvntaelleGvkqrhelfvdelek 317 ++pdilt+akalGgGfpi a+ltt+e+a++lkvGthG+tyGGnplaca+ ++vld+vnt+e+l+Gvk+r++l+ d l+k lcl|FitnessBrowser__MR1:199805 245 IVPDILTTAKALGGGFPIAAMLTTTEIAEHLKVGTHGSTYGGNPLACAIGNAVLDVVNTPEVLNGVKHREQLLRDGLNK 323 ******************************************************************************* PP TIGR03246 318 inarykvfseirGkGlliGavlteeyaGkakdlvnaaaeeGvlvliaGpdvvrfapslvieeeeikeGlarlekavekl 396 in++y+vfse+rGkGll+Gavl+e+y+G+++d++ a+ +eG++ l+aG++vvrfapslvi+e++i+eGlar+e+av+++ lcl|FitnessBrowser__MR1:199805 324 INEKYHVFSEVRGKGLLLGAVLNEQYQGRSRDFLVASVAEGLMSLMAGANVVRFAPSLVIPEADIAEGLARFERAVASI 402 ****************************************************************************976 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (397 nodes) Target sequences: 1 (405 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 11.10 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory