Align Succinylornithine transaminase (EC 2.6.1.81) (characterized)
to candidate 201879 SO2741 adenosylmethionine--8-amino-7-oxononanoate aminotransferase (NCBI ptt file)
Query= reanno::pseudo1_N1B4:Pf1N1B4_3440 (406 letters) >FitnessBrowser__MR1:201879 Length = 461 Score = 157 bits (398), Expect = 5e-43 Identities = 115/331 (34%), Positives = 173/331 (52%), Gaps = 36/331 (10%) Query: 12 DFDQVMV--PNYAPAAFIPVRGA----GSRVWDQSGRELIDFAGGIAVNVLGHAHPALVA 65 DFD + P + +PV G G + GR+LID V G+ HPA++ Sbjct: 8 DFDSAHIWHPYTSMTRALPVFGVHSAQGCELELVDGRKLIDGTSSWWACVHGYGHPAILT 67 Query: 66 ALTEQANKLWHVS-NVFTNEPALRLAHKLVDATFAE--RVFFCNSGAEANEAAFKLARRV 122 A+ +Q ++L HV T+EPA+ L KL+ T +VF C+SG+ A E A K+A + Sbjct: 68 AMEQQLHQLSHVMFGGITHEPAIELCKKLLAMTCEPLTKVFLCDSGSIAVEVAIKMALQY 127 Query: 123 AHDRF-----GTEKYEIVAALNSFHGRTLFTVNV-----GGQSKYSDGF-------GPKI 165 + +K I+ +HG T ++V G + + + P+ Sbjct: 128 WQGQDLPLAQKAQKQRILTVKKGYHGDTFAAMSVCDPEGGMHTMFGEAVIKQCFVDAPQT 187 Query: 166 TGITHVPYNDLAALKAAVSDK---TCAVVLEPI-QGEGGVLPAELSYLQGARELCDAHNA 221 + +DLA ++ + ++ AV++EPI QG GG+ YL+G R LCD +N Sbjct: 188 PFGESLHQDDLAPMQRILREQHQDIAAVIIEPIMQGAGGMRFYSSEYLRGLRALCDEYNV 247 Query: 222 LLVFDEVQTGMGRSGKLFAYQHYGVTPDILTSAKSLGGGF-PIAAMLTTEDLAKHLV--- 277 LL+ DE+ TG GR+GKLFAY+H +TPDIL K+L GG+ +AA L T+++A+ + Sbjct: 248 LLILDEIATGFGRTGKLFAYEHTDITPDILCLGKALTGGYISLAATLCTDNVAQGISQSP 307 Query: 278 --VGTHGTTYGGNPLACAVAEAVIDVINTPE 306 V HG T+ GNPLACA A A +D+IN E Sbjct: 308 AGVFMHGPTFMGNPLACAAACASLDLINQQE 338 Lambda K H 0.320 0.136 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 419 Number of extensions: 24 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 461 Length adjustment: 32 Effective length of query: 374 Effective length of database: 429 Effective search space: 160446 Effective search space used: 160446 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory