GapMind for catabolism of small carbon sources

 

Aligments for a candidate for adh in Shewanella oneidensis MR-1

Align Aldehyde dehydrogenase family 2 member C4; ALDH1a; Protein REDUCED EPIDERMAL FLUORESCENCE 1; EC 1.2.1.3 (characterized)
to candidate 202599 SO3496 aldehyde dehydrogenase (NCBI ptt file)

Query= SwissProt::Q56YU0
         (501 letters)



>lcl|FitnessBrowser__MR1:202599 SO3496 aldehyde dehydrogenase (NCBI
           ptt file)
          Length = 498

 Score =  407 bits (1047), Expect = e-118
 Identities = 202/473 (42%), Positives = 310/473 (65%), Gaps = 4/473 (0%)

Query: 21  KLFINGQFIDAASGKTFETIDPRNGEVIATIAEGDKEDVDLAVNAARYAFDHGPWPRMTG 80
           K FING++ DA+SG TF+ I P +G ++A +A  D  D ++AV  AR  FD G W +   
Sbjct: 22  KAFINGEYRDASSGNTFDCISPIDGRLLAPVASCDLMDANIAVANAREVFDSGVWSKAAP 81

Query: 81  FERAKLINKFADLIEENIEELAKLDAVDGGKLFQLGKYADIPATAGHFRYNAGAADKIHG 140
            +R +++ +FA+L+EEN  ELA L+ +D GK  +  K  D+   A   R++  A DK++ 
Sbjct: 82  VKRKQVMIRFAELLEENANELALLETLDMGKPIRFSKAVDVAGAARAIRWSGEAIDKLYD 141

Query: 141 ETLKMTRQSLFGYTLKEPIGVVGNIIPWNFPSIMFATKVAPAMAAGCTMVVKPAEQTSLS 200
           E L  T  +  G   +EP+GVV  I+PWNFP +M   K+ PA+  G ++++KP+E++ L+
Sbjct: 142 E-LAPTAHNEIGMITREPVGVVAAIVPWNFPLLMACWKLGPALVTGNSVILKPSEKSPLT 200

Query: 201 ALFYAHLSKEAGIPDGVLNIVTGFGSTAGAAIASHMDVDKVSFTGSTDVGRKIMQAAAAS 260
           A+  A L+ +AGIP GVLN++ G+G T G A+A HMDVD + FTGST + +++M  A  S
Sbjct: 201 AIRIAELAVQAGIPKGVLNVLPGYGHTVGKALALHMDVDTLVFTGSTKIAKQLMIYAGES 260

Query: 261 NLKKVSLELGGKSPLLIFNDA-DIDKAADLALLGCFYNKGEICVASSRVFVQEGIYDKVV 319
           N+K+V LE GGKSP ++FNDA D+  AA  A     +N+GE+C A SR+ V+ G+ D++V
Sbjct: 261 NMKRVWLEAGGKSPNIVFNDAPDLKAAAVAAAEAIGFNQGEVCTAGSRLLVESGVKDELV 320

Query: 320 EKLVEKAKDWTVGDPFDSTARQGPQVDKRQFEKILSYIEHGKNEGATLLTGGKAI--GDK 377
             + E+   W  G P + T   G  VDK+Q + ILSYI+ G+NEGA+L+ GG+ +     
Sbjct: 321 GLIAEELASWQPGHPLEPTTVSGAVVDKQQLDTILSYIKAGQNEGASLVYGGQQVLAETG 380

Query: 378 GYFIQPTIFADVTEDMKIYQDEIFGPVMSLMKFKTVEEGIKCANNTKYGLAAGILSQDID 437
           G ++QPT+F++V   MKI  +EIFGPV+S+++F  +EE I  AN+T YGLAAG+ + DI 
Sbjct: 381 GVYVQPTVFSNVKNQMKIASEEIFGPVLSVIEFNGMEEAIAIANDTIYGLAAGVWTADIS 440

Query: 438 LINTVSRSIKAGIIWVNCYFGFDLDCPYGGYKMSGNCRESGMDALDNYLQTKS 490
             +  ++++++G++W+N Y G D+  P+GGYK SGN R+  + + D Y + K+
Sbjct: 441 KAHKTAKALRSGMVWINHYDGGDMTAPFGGYKQSGNGRDKSLHSFDKYTEIKA 493


Lambda     K      H
   0.318    0.136    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 637
Number of extensions: 33
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 501
Length of database: 498
Length adjustment: 34
Effective length of query: 467
Effective length of database: 464
Effective search space:   216688
Effective search space used:   216688
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory