Align purine-nucleoside phosphorylase (EC 2.4.2.1) (characterized)
to candidate 201857 SO2719 purine nucleoside phosphorylase (NCBI ptt file)
Query= BRENDA::P0ABP8 (239 letters) >FitnessBrowser__MR1:201857 Length = 234 Score = 260 bits (665), Expect = 1e-74 Identities = 128/232 (55%), Positives = 167/232 (71%) Query: 3 TPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMG 62 T HINA+ DFA+ V+MPGDPLRAKYIAET+L DA EV NVR MLG+TG Y+G++ISVMG Sbjct: 2 TAHINAQPTDFAETVIMPGDPLRAKYIAETYLTDAVEVTNVRNMLGYTGYYQGQRISVMG 61 Query: 63 HGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFK 122 HGMGI S +Y ELI FGVK+IIR+GS GA HV++RDV++ A TDS N R Sbjct: 62 HGMGISSMVLYGHELINFFGVKRIIRIGSLGATQQHVEMRDVILAQAAGTDSPTNAKRSS 121 Query: 123 DHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEME 182 + A A F ++ A A GI +VGN+FS DL+Y PD +M +E++G+LG++ME Sbjct: 122 GYHMATSATFSLLHKAYTKANEKGISVKVGNVFSGDLYYDPDEDMIPALERFGVLGIDME 181 Query: 183 AAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESVL 234 AG+YG+A + G ++L I TVSDH T E+TTA ERQ +FN+MI++ALE+ L Sbjct: 182 VAGLYGLAHQQGIESLAILTVSDHCLTGEETTAQERQLSFNNMIELALETAL 233 Lambda K H 0.322 0.138 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 191 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 239 Length of database: 234 Length adjustment: 23 Effective length of query: 216 Effective length of database: 211 Effective search space: 45576 Effective search space used: 45576 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
Align candidate 201857 SO2719 (purine nucleoside phosphorylase (NCBI ptt file))
to HMM TIGR00107 (deoD: purine nucleoside phosphorylase (EC 2.4.2.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00107.hmm # target sequence database: /tmp/gapView.10776.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00107 [M=232] Accession: TIGR00107 Description: deoD: purine nucleoside phosphorylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-95 305.2 0.1 1.6e-95 305.0 0.1 1.0 1 lcl|FitnessBrowser__MR1:201857 SO2719 purine nucleoside phospho Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__MR1:201857 SO2719 purine nucleoside phosphorylase (NCBI ptt file) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 305.0 0.1 1.6e-95 1.6e-95 1 229 [. 4 232 .. 4 234 .] 0.99 Alignments for each domain: == domain 1 score: 305.0 bits; conditional E-value: 1.6e-95 TIGR00107 1 hinakkgdiadvvllpGdPlrakyiaekfledakevnevrgmlgftGkykgkkisvmGhGmGipsisiyskelikeyev 79 hina+ d+a++v++pGdPlrakyiae++l da ev++vr+mlg+tG y+g++isvmGhGmGi+s+ +y +eli++++v lcl|FitnessBrowser__MR1:201857 4 HINAQPTDFAETVIMPGDPLRAKYIAETYLTDAVEVTNVRNMLGYTGYYQGQRISVMGHGMGISSMVLYGHELINFFGV 82 9****************************************************************************** PP TIGR00107 80 kkiirvGsCGairkkvklkdviialkastdskvnrvrfvevdlaaiadfelvklakeaakkkgldvkvGnvfsadlfys 158 k+iir+Gs Ga +++v+++dvi+a+ a tds +n r +a+ a+f+l+++a+ a++kg++vkvGnvfs dl+y+ lcl|FitnessBrowser__MR1:201857 83 KRIIRIGSLGATQQHVEMRDVILAQAAGTDSPTNAKRSSGYHMATSATFSLLHKAYTKANEKGISVKVGNVFSGDLYYD 161 ******************************************************************************* PP TIGR00107 159 tdkevldllekygvlavemeaaalyavaaelgkkaltlltvsdhlvthealtaeerqktfkdmielalesv 229 +d++++ le+ gvl+++me a+ly++a + g ++l++ltvsdh +t e++ta+erq +f++mielale++ lcl|FitnessBrowser__MR1:201857 162 PDEDMIPALERFGVLGIDMEVAGLYGLAHQQGIESLAILTVSDHCLTGEETTAQERQLSFNNMIELALETA 232 ********************************************************************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (232 nodes) Target sequences: 1 (234 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 9.61 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory