Align 2-deoxy-D-ribonate 3-dehydrogenase (characterized)
to candidate 199630 SO0438 oxidoreductase, short chain dehydrogenase/reductase family (NCBI ptt file)
Query= reanno::BFirm:BPHYT_RS04775 (263 letters) >FitnessBrowser__MR1:199630 Length = 267 Score = 87.0 bits (214), Expect = 4e-22 Identities = 66/207 (31%), Positives = 97/207 (46%), Gaps = 16/207 (7%) Query: 12 GLRVLISGAAAGIGAAIAQAFLDVGANVYICDVDPAAIDRARTAHPQLHAG--------- 62 G V+I+GA+ GIG A+A A +G C + +A + R A L Sbjct: 6 GKVVIITGASEGIGRALAIAMARIG-----CQLVLSARNETRLASLALEVANYGPTPFVF 60 Query: 63 VADVSDCAQVDRIIDDARSKLGGLDLLINNAGIAGPTGAVEDLDPAEWERTIGTNLNSQF 122 ADVS +Q + +I + G +D+L+NNAG+ + E + E + N Sbjct: 61 AADVSSASQCEDLIHATIAHYGRIDILVNNAGMTMWSRFDELTQLSVLEDIMRVNYLGPA 120 Query: 123 YFLRKAVPLLKETSANPGIIAMASVAGRLGYAFRTPYAASKWAIVGMVKSLAIELGPNNV 182 Y A+P LK + ++ +ASVAG G R+ YAASK A++G SL IEL +NV Sbjct: 121 YLTHAALPYLKSSQGQ--VVIVASVAGLTGVPTRSGYAASKHAVIGFFDSLRIELADDNV 178 Query: 183 RVNAILPGVVEGERMDRVISARAESLG 209 V I P V + R + + LG Sbjct: 179 AVTVICPDFVVSQIHKRALDGAGKPLG 205 Lambda K H 0.320 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 145 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 267 Length adjustment: 25 Effective length of query: 238 Effective length of database: 242 Effective search space: 57596 Effective search space used: 57596 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory