Align Short-chain dehydrogenase/reductase SDR (characterized, see rationale)
to candidate 202371 SO3263 3-oxoacyl-(acyl-carrier-protein) reductase, putative (NCBI ptt file)
Query= uniprot:B2T9V3 (247 letters) >FitnessBrowser__MR1:202371 Length = 255 Score = 105 bits (262), Expect = 9e-28 Identities = 75/249 (30%), Positives = 118/249 (47%), Gaps = 23/249 (9%) Query: 8 KTALITAAGQGIGLATAELFAREGARVIAT-------DIRIDGLAGKPVEARKLDVRDDA 60 K LIT +GIG A+ FA G V T + + + G V A LD Sbjct: 14 KLVLITGGSRGIGAGIAKAFAEAGYWVAITYLNHQDKAVSLANILGDKVAAFALDQSKPE 73 Query: 61 AIKALAAEIG-----AVDVLFNCAGFVHAGNILECSEEDWDFAFDLNVKAMYRMIRAFLP 115 +IK E+ ++DVL N + + +D+ + N++ + + +A +P Sbjct: 74 SIKQCITEVEKYFNRSIDVLINNGAIAQEKPFSDITADDFTTMLNTNLRGPFLLAQACIP 133 Query: 116 AMLDKGGGSIINMSSAASSVKGVPNRFAYSASKAAVIGLTKSVAADFITRGVRCNAICPG 175 AM G G IIN+ S G N+ Y+A+KA +I L++S+A + G+R N I G Sbjct: 134 AMQQHGFGRIINIGSIGGQWGGY-NQVHYAAAKAGLINLSQSIAKIYSRDGIRTNTIAIG 192 Query: 176 TVASPSLEQRIVAQAQAQGATLDAVQAAFVARQPMGRIGKPEEIAALALYLGSDESSFTT 235 VA+ E + +A Q A A P+GR+GK E+IA++AL+L S +S + + Sbjct: 193 LVATEMTEHELTTEAGKQKA----------AAIPVGRLGKVEDIASIALFLASQDSDYLS 242 Query: 236 GHAHVIDGG 244 G +GG Sbjct: 243 GQTLNANGG 251 Lambda K H 0.320 0.133 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 120 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 255 Length adjustment: 24 Effective length of query: 223 Effective length of database: 231 Effective search space: 51513 Effective search space used: 51513 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory