Align UDP-glucose 4-epimerase; EC 5.1.3.2; Galactowaldenase; UDP-galactose 4-epimerase (uncharacterized)
to candidate 202283 SO3173 UDP-galactose 4-epimerase, putative (NCBI ptt file)
Query= curated2:Q56623 (328 letters) >FitnessBrowser__MR1:202283 Length = 309 Score = 295 bits (754), Expect = 1e-84 Identities = 156/308 (50%), Positives = 210/308 (68%), Gaps = 7/308 (2%) Query: 10 KSILLTGSTGFVGTNLVKSLTLKSDYIVKSAVRHAVNKDDGLLFEVGDINASTDFELPLK 69 +SILLTG+TGFVG +++ L + ++ + F G++ A+TD+ L Sbjct: 4 QSILLTGATGFVGQQILRQLPQDTRVFGRTKPARDCH------FFAGELTANTDYRSALS 57 Query: 70 NTTVVVHCAARAHVMDDKEAEPLTLYREVNTAGTVNLAKQAIDSGVKRFIFISSIKVNGE 129 VV+HCAARAHVM++ LY+EVNT T+ LA+QA +GVKRFIFIS+IKVNGE Sbjct: 58 GVDVVIHCAARAHVMNETANNAAQLYQEVNTLVTLALAEQAAAAGVKRFIFISTIKVNGE 117 Query: 130 GTLVGCPFKTEDNHAPEDDYGLSKSEAEKQLVALAKDSSMEVVIIRPTIVYGPGVKANFA 189 T+ G F+ D P D YG SK++AE L +A+ + +EVVIIRP +VYGP VKANFA Sbjct: 118 ATIAGQLFRASDARQPLDHYGESKAKAEIGLFDIARKTEIEVVIIRPPLVYGPNVKANFA 177 Query: 190 SLMRLVSKGIPLPFGSITQNKRSLVSINNLVDLIVTCIDHPKAANQVFLVSDGHDVSTAE 249 +++ L K +PLPFG+I NKRS+V+++NLVDLIVTCI+HP AANQ+FLVSD DVST E Sbjct: 178 TMLNLAKKNLPLPFGAI-HNKRSMVALDNLVDLIVTCIEHPNAANQIFLVSDDQDVSTTE 236 Query: 250 MVRELAIALDKPTWQLPVPIWCYKLFGKLFGKSDIVDRLTGTLQVDISHTKETLGWKPPQ 309 +++ + A K LPVP+ L GK+ G I+DRL G LQVDI+HTK TL W+PP Sbjct: 237 LLKLMTGAAGKKPRLLPVPMAWLILAGKVTGNQAIIDRLCGNLQVDITHTKNTLSWQPPI 296 Query: 310 TLQEGFKQ 317 T++EG ++ Sbjct: 297 TVEEGVRR 304 Lambda K H 0.318 0.134 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 289 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 309 Length adjustment: 27 Effective length of query: 301 Effective length of database: 282 Effective search space: 84882 Effective search space used: 84882 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory