Align N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized)
to candidate 203725 SO4655 sulfate ABC transporter, ATP-binding protein (NCBI ptt file)
Query= reanno::Smeli:SMc02869 (352 letters) >FitnessBrowser__MR1:203725 Length = 354 Score = 216 bits (550), Expect = 7e-61 Identities = 118/272 (43%), Positives = 168/272 (61%), Gaps = 6/272 (2%) Query: 19 SLQLKTIRKAFGSHEVLKGIDLDVKDGEFVIFVGPSGCGKSTLLRTIAGLEDATSGSVQI 78 S+ ++ + K FG+ + ++L++K GE +GPSG GK+TLLR IAGLE A SG V+ Sbjct: 2 SIHIQQVNKHFGNFVAVDSVNLEIKTGELTALLGPSGSGKTTLLRIIAGLEQADSGIVKF 61 Query: 79 DGVEVGHVAPAKRGIAMVFQSYALYPHLTVKDNMGLGL----KQAGVPKAEIEEKVAKAA 134 +G ++ ++RG+ VFQ YAL+ H+TV +N+ GL ++ KAEI EKV Sbjct: 62 NGEDITTQHVSERGVGFVFQHYALFKHMTVFENVAYGLTVRPRKTRPSKAEIAEKVHSLL 121 Query: 135 GMLSLEPYLARRPAELSGGQRQRVAIGRAIVREPKLFLFDEPLSNLDAALRVNTRLEIAR 194 ++ L+ R P++LSGGQRQR+A+ RA+ EPK+ L DEP LDA +R R + R Sbjct: 122 KLVQLDWTADRYPSQLSGGQRQRIALARALAVEPKVLLLDEPFGALDAKVRAELRRWLRR 181 Query: 195 LHRSLKATMIYVTHDQVEAMTLADKIVVLNAGRIEQVGSPMELYNRPANLFVAGFIGSPQ 254 LH + T ++VTHDQ EA+ +ADKIVV+N GRIEQ G+P E+Y+ P+N FV F+G+ Sbjct: 182 LHDEINVTTVFVTHDQEEALEVADKIVVMNKGRIEQQGTPEEVYDTPSNPFVYEFLGNVN 241 Query: 255 MNFIEAAKLGDGEAKTIGI-RPEHIGLSRESG 285 + F K G I I PEH G + G Sbjct: 242 L-FHARVKHGHSTIGNIHIPSPEHAGGEEQQG 272 Lambda K H 0.320 0.137 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 299 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 352 Length of database: 354 Length adjustment: 29 Effective length of query: 323 Effective length of database: 325 Effective search space: 104975 Effective search space used: 104975 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory