Align N-acetylglucosamine-specific PTS system, I, HPr, and IIA components (nagF) (characterized)
to candidate 201387 SO2237 phosphoenolpyruvate-protein phosphotransferase (NCBI ptt file)
Query= reanno::pseudo3_N2E3:AO353_04460 (838 letters) >FitnessBrowser__MR1:201387 Length = 567 Score = 288 bits (736), Expect = 8e-82 Identities = 180/508 (35%), Positives = 270/508 (53%), Gaps = 9/508 (1%) Query: 319 RALEQVRSEIRETLSHAKKHKHTEEEQIFAAHLALLEDPALLEAAIQSIDQGSAATHAWS 378 +AL+ ++ ++ +LS AK +E Q+ A L LL+D L+E ++I + Sbjct: 46 KALQALKQQL--SLSQAKLDPESENYQLIEADLLLLDDDELIEQVKEAIRTLQLSASVAV 103 Query: 379 QSIEA-QCEVLQQLGNPLLAERANDLRDLRQRVLRALLG--QDWHYDVPAGAIVAAHELT 435 + I A Q L+ L +P LA RA D+R L QR++ A+ G + D+ I+ A +LT Sbjct: 104 ERIFAHQANELESLDDPYLANRAQDVRCLGQRIVTAINGRLEQGLADLSEATILLAQDLT 163 Query: 436 PSDLLQLSQQGVAGLCMAEGGATSHVAILARGKGLPCLVALSASLLQQPQGQSVVLDADG 495 P++ L ++ ++G+ + GG TSH AILAR G+P +++ P +VLDA Sbjct: 164 PAEFALLPKEHISGIVLKTGGLTSHTAILARAAGIPAMLSCQFDAEFIPNNTPLVLDALS 223 Query: 496 GRLELTPDSQRLEQVAQAQREHLQRRERQQAQAHTPAHTRDGLRIEVAANVASSNEAADA 555 G L + P+ ++ ++ RR+ Q PA T+DG + + ANV + NE Sbjct: 224 GVLYVNPEPEQQARLTVTLHHEQARRQALQTYRDVPAQTQDGHHVGLLANVGNLNEITHV 283 Query: 556 LKGGADGVGLLRTEFLFVDRQTAPDEQEQRQAYQAVLDAMGDKSVIIRTIDVGGDKQLDY 615 GADG+GL RTEF+ ++ T PDE+ Q Y L A+ K+ IRT+D+G DK+L Sbjct: 284 KDEGADGIGLFRTEFMLMNTSTLPDEKAQYNLYCEALHALDGKTFTIRTLDIGADKELPC 343 Query: 616 LPLPAEANPVLGLRGIRMAQVRPELLDQQLRALLQVSPLQRCRILLPMVTEVDEL----L 671 L E NP LG RG+R PEL QLRA+L+ + R++ PMV +V+EL Sbjct: 344 LCQNIEDNPALGQRGVRYTLAHPELFKTQLRAILRAANHGPIRLMFPMVNQVEELDEIFK 403 Query: 672 YIRQRLDALCAELALTQRLELGVMIEVPAAALLAEQLAEHADFLSIGTNDLSQYTLAMDR 731 I + DAL E L G+++E PAA L + DF+SIGTNDL+QY +A DR Sbjct: 404 LIAECQDALEEEEKGYGELSYGIVVETPAAVLNLASMLPRLDFVSIGTNDLTQYAMAADR 463 Query: 732 DHAGLAARVDALHPALLRLIAQTCIGAAKHQRWVGVCGALASDPLATPVLIGLGISELSV 791 + L +L PA+L LI T A V +CG LAS P P+L+G+G+ ELSV Sbjct: 464 TNPQLTKDYPSLSPAILHLINMTITQAKATGVTVSLCGELASSPQMAPLLVGMGLDELSV 523 Query: 792 SPPQVGEIKERVRQLDAADCRRFSATLL 819 + + E+K + Q + A + T + Sbjct: 524 NLSSLLEVKAAICQGELAKFSELAHTAM 551 Lambda K H 0.318 0.133 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 955 Number of extensions: 43 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 838 Length of database: 567 Length adjustment: 39 Effective length of query: 799 Effective length of database: 528 Effective search space: 421872 Effective search space used: 421872 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 54 (25.4 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory