Align N-acetyl-D-glucosamine kinase; EC 2.7.1.59; GlcNAc kinase (uncharacterized)
to candidate 200564 SO1389 ROK family protein (NCBI ptt file)
Query= curated2:Q9KRV2 (302 letters) >FitnessBrowser__MR1:200564 Length = 264 Score = 49.7 bits (117), Expect = 7e-11 Identities = 50/158 (31%), Positives = 75/158 (47%), Gaps = 17/158 (10%) Query: 6 DVGGTKIEFGAFNEQLERVATERVATPTDDYAKLVET---IAGLVHKYDAQFGVEGTVGL 62 DVGG+K F E + TE+ PT + K+ + IA L YD Q + + Sbjct: 7 DVGGSKALF----ELQLKGHTEQYKIPTGEGFKIEDLNNQIAALERDYDLQ---HYHLAI 59 Query: 63 GIPGMEDADNGCVLTVNVPAAKGKPLRADLETKLGRAVKVENDANCFALSEAWDDELKEA 122 +PG+ N V ++P G L D G+ + ND + A +A DE K A Sbjct: 60 AVPGLVQ-QNRLVSCKSLPGLNG--LSFDTLKTQGQLKFICNDID--AGMQATCDE-KYA 113 Query: 123 ASVMGLILGTGFGGGLVYEGKVFSGRNHVAGEIGHMRL 160 ++ ++ GTG G + + GK F+G VAGE+GH R+ Sbjct: 114 CELL-VMCGTGIGMSIAFNGKAFTGATGVAGELGHCRV 150 Lambda K H 0.319 0.140 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 210 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 302 Length of database: 264 Length adjustment: 26 Effective length of query: 276 Effective length of database: 238 Effective search space: 65688 Effective search space used: 65688 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory