Align Histidine transport ATP-binding protein HisP (characterized)
to candidate 200007 SO0821 ABC transporter, ATP-binding/permease protein (NCBI ptt file)
Query= SwissProt::P02915 (258 letters) >FitnessBrowser__MR1:200007 Length = 656 Score = 144 bits (362), Expect = 6e-39 Identities = 84/211 (39%), Positives = 130/211 (61%), Gaps = 12/211 (5%) Query: 21 VLKGVSLQARAGDVISIIGSSGSGKSTFLRCINFLEKPSEGAIIVNGQNINLVRDKDGQL 80 VLK ++L G++++I+G+SGSGKST + + L+KPS+GA ++GQ+ + Q+ Sbjct: 24 VLKDINLSIARGEMVAIVGASGSGKSTLMNILGCLDKPSKGAYFIDGQDTS-------QM 76 Query: 81 KVADKNQLRLLRTRLTMVFQHFNLWSHMTVLENVMEAPIQVLGLSKHDARERALKYLAKV 140 V + +LR R +FQ ++L + + NV E P G + + R+RA L+++ Sbjct: 77 DVDELAKLR--REHFGFIFQRYHLLGDLNAVGNV-EVPAVYAGKDRLERRDRAESLLSRL 133 Query: 141 GIDERAQGKYPVHLSGGQQQRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRIMQQLA 200 G+ ER K P LSGGQQQRVS+ARAL DV+L DEPT ALD E++R++Q+L Sbjct: 134 GLGERLDHK-PNQLSGGQQQRVSVARALMNGGDVILADEPTGALDSHSGEEMMRLLQELH 192 Query: 201 EEGKTMVVVTHEMGFARHVSSHVIFLHQGKI 231 EG T+++VTH+M A+H + +I + G I Sbjct: 193 REGHTIIIVTHDMHVAQH-ADRIIEIKDGVI 222 Lambda K H 0.319 0.136 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 337 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 656 Length adjustment: 31 Effective length of query: 227 Effective length of database: 625 Effective search space: 141875 Effective search space used: 141875 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory