GapMind for catabolism of small carbon sources

 

Aligments for a candidate for hutH in Shewanella oneidensis MR-1

Align histidine ammonia-lyase (EC 4.3.1.3) (characterized)
to candidate 203452 SO4374 histidine ammonia-lyase, putative (NCBI ptt file)

Query= BRENDA::P42357
         (657 letters)



>lcl|FitnessBrowser__MR1:203452 SO4374 histidine ammonia-lyase,
           putative (NCBI ptt file)
          Length = 521

 Score =  294 bits (753), Expect = 6e-84
 Identities = 188/497 (37%), Positives = 277/497 (55%), Gaps = 22/497 (4%)

Query: 111 EKYIELDGDRLTTEDLVNLGKGRYKIKLTPTAEKR--VQKSREVIDSIIKEKTVVYGITT 168
           E  IE     LT E +V + KG  K+KL   A+ +  +QK    IDS++ E+ VVYG+TT
Sbjct: 12  ESPIEFGRQLLTLEQVVAVAKGA-KVKLCDDADYQEYIQKGARFIDSLLHEEGVVYGVTT 70

Query: 169 GFGKFARTVIPINKLQELQVNLVRSHSSGVGKPLSPERCRMLLALRINVLAKGYSGISLE 228
           G+G      + ++ + EL ++L R H  G+G+ LS  + R ++A R+N LA G SG++ E
Sbjct: 71  GYGDSCTVNVSLDLVHELPLHLSRFHGCGLGEVLSVMQARAVMACRLNSLAIGKSGVTYE 130

Query: 229 TLKQVIEMFNASCLPYVPEKGTVGASGDLAPLSHLALGLVGEGKMWSPKSGWADAKYVLE 288
            LK++  + N + +P +PE+G+VGASGDL PLS+LA  LVGE ++       A  K V  
Sbjct: 131 LLKRIQTLLNLNIVPVIPEEGSVGASGDLTPLSYLAAVLVGEREVIYQGERRA-TKEVYH 189

Query: 289 AHGLKPVILKPKEGLALINGTQMITSLGCEAVERASAIARQADIVAALTLEVLKGTTKAF 348
              + P +L+PKEGLAL+NGT ++T+L C A +RA  +AR A  + A+    LKG +  F
Sbjct: 190 ELNITPHVLRPKEGLALMNGTAVMTALACLAFDRAQYLARLASRITAMASLTLKGNSNHF 249

Query: 349 DTDIHALRPHRGQIEVAFRFRSLLDSDHHPSEIAESHRFCDRVQDAYTLRCCPQVHGVVN 408
           D  + A +PH GQ ++A   R  L+   HP       R  DR+QD Y++RC P + GV+ 
Sbjct: 250 DDILFAAKPHPGQNQIATWIREDLNHHVHP-------RNSDRLQDRYSIRCAPHIIGVLQ 302

Query: 409 DTIAFVKNIITTELNSATDNPMVFANRGETVSGGNFHGEYPAKALDYLAIGIHELAAISE 468
           D + F++  I TE+NSA DNP+V A     + GG+F+G + A A+D L   +  +A + +
Sbjct: 303 DALPFMRQFIETEVNSANDNPIVDAEGEHILHGGHFYGGHIAFAMDSLKNIVANIADLID 362

Query: 469 RRIERLCNPSLSE-LPAFLVAEGG----LNSGFMIAHCTAAALVSENKALCHPSSVDSLS 523
           R++  + +P  +  LPA L    G    +N GF       +A  +E      P+SV S S
Sbjct: 363 RQMALVMDPKFNNGLPANLSGSTGPRRAINHGFKAVQIGVSAWTAEALKHTMPASVFSRS 422

Query: 524 TSAATEDHVSMGGWAARKALRVIEHVEQVLAIELLAACQGIEF------LRPLKTTTPLE 577
           T    +D VSMG  AAR  +RV++  EQV A  LLA  QGI+       L     T  L 
Sbjct: 423 TECHNQDKVSMGTIAARDCMRVLQLTEQVAAAALLAMTQGIDLRITQNELDEASLTPSLA 482

Query: 578 KVYDLVRSVVRPWIKDR 594
                VR+   P ++DR
Sbjct: 483 TTLAQVRADFEPLVEDR 499


Lambda     K      H
   0.319    0.135    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 720
Number of extensions: 31
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 657
Length of database: 521
Length adjustment: 37
Effective length of query: 620
Effective length of database: 484
Effective search space:   300080
Effective search space used:   300080
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory