Align 3-hydroxyacyl-CoA dehydrogenase IvdG; EC 1.1.1.35 (characterized, see rationale)
to candidate 202371 SO3263 3-oxoacyl-(acyl-carrier-protein) reductase, putative (NCBI ptt file)
Query= uniprot:Q8EGC1 (252 letters) >FitnessBrowser__MR1:202371 Length = 255 Score = 120 bits (300), Expect = 4e-32 Identities = 87/251 (34%), Positives = 140/251 (55%), Gaps = 18/251 (7%) Query: 6 KVVVITGGAGGLGLAMAHNFAQAGAKLALIDVD-QDKLERACADLGSSTEVQGYALDITD 64 K+V+ITGG+ G+G +A FA+AG +A+ ++ QDK LG +V +ALD + Sbjct: 14 KLVLITGGSRGIGAGIAKAFAEAGYWVAITYLNHQDKAVSLANILGD--KVAAFALDQSK 71 Query: 65 EEDVVAGFAYILEDFGK-INVLVNNAGILRDGMLVKAKDGKVTDRMSFDQFQSVINVNLT 123 E + + + F + I+VL+NN I ++ K ++ D F +++N NL Sbjct: 72 PESIKQCITEVEKYFNRSIDVLINNGAIAQE---------KPFSDITADDFTTMLNTNLR 122 Query: 124 GTFLCGREAAAAMIESGQAGVIVNISSLA-KAGNVGQSNYAASKAGVAAMSVGWAKELAR 182 G FL + AM + G G I+NI S+ + G Q +YAA+KAG+ +S AK +R Sbjct: 123 GPFLLAQACIPAMQQHG-FGRIINIGSIGGQWGGYNQVHYAAAKAGLINLSQSIAKIYSR 181 Query: 183 YNIRSAAVAPGVIATEMTA-AMKPEALERLEKLVPVGRLGHAEEIASTVRFII--ENDYV 239 IR+ +A G++ATEMT + EA ++ +PVGRLG E+IAS F+ ++DY+ Sbjct: 182 DGIRTNTIAIGLVATEMTEHELTTEAGKQKAAAIPVGRLGKVEDIASIALFLASQDSDYL 241 Query: 240 NGRVFEVDGGI 250 +G+ +GG+ Sbjct: 242 SGQTLNANGGM 252 Lambda K H 0.317 0.134 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 171 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 252 Length of database: 255 Length adjustment: 24 Effective length of query: 228 Effective length of database: 231 Effective search space: 52668 Effective search space used: 52668 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory