Align UDP-glucose 4-epimerase (EC 5.1.3.7; EC 5.1.3.2) (characterized)
to candidate 200829 SO1664 UDP-glucose 4-epimerase (NCBI ptt file)
Query= metacyc::BSU38860-MONOMER (339 letters) >FitnessBrowser__MR1:200829 Length = 337 Score = 484 bits (1246), Expect = e-141 Identities = 233/336 (69%), Positives = 271/336 (80%) Query: 1 MAILVTGGAGYIGSHTCVELLNSGYEIVVLDNLSNSSAEALNRVKEITGKDLTFYEADLL 60 M ILVTGGAGYIG+HT VELLN+G E++VLDNLSNSS EAL+RV+ ITGK +TFY+ D+L Sbjct: 1 MTILVTGGAGYIGTHTVVELLNAGSEVIVLDNLSNSSIEALDRVERITGKSVTFYQGDIL 60 Query: 61 DREAVDSVFAENEIEAVIHFAGLKAVGESVAIPLKYYHNNLTGTFILCEAMEKYGVKKIV 120 ++ + VF+++ I+AVIHFAGLKAVGESVA PLKYY NN+TGT ILC+ M ++ VK +V Sbjct: 61 NKALLQKVFSDHSIDAVIHFAGLKAVGESVAKPLKYYENNVTGTLILCQVMAEFKVKNLV 120 Query: 121 FSSSATVYGVPETSPITEDFPLGATNPYGQTKLMLEQILRDLHTADNEWSVALLRYFNPF 180 FSSSATVYG P + PITEDFP GATNPYGQ+KLM+E IL DLH +D W++A LRYFNP Sbjct: 121 FSSSATVYGDPASLPITEDFPTGATNPYGQSKLMVEHILADLHHSDPSWNIARLRYFNPV 180 Query: 181 GAHPSGRIGEDPNGIPNNLMPYVAQVAVGKLEQLSVFGNDYPTKDGTGVRDYIHVVDLAE 240 GAH SG IGEDPN IPNNLMP++AQVAVGK E LSVFGNDYPT DGTGVRDYIHVVDLA Sbjct: 181 GAHASGLIGEDPNDIPNNLMPFIAQVAVGKREALSVFGNDYPTHDGTGVRDYIHVVDLAI 240 Query: 241 GHVKALEKVLNSTGADAYNLGTGTGYSVLEMVKAFEKVSGKEVPYRFADRRPGDIATCFA 300 GH+KALEK+ G YNLGTG GYSVL+MVKAFEK GK + Y A RRPGDIA C+A Sbjct: 241 GHLKALEKLATKPGLVTYNLGTGQGYSVLDMVKAFEKACGKSIAYLIAPRRPGDIAACYA 300 Query: 301 DPAKAKRELGWEAKRGLEEMCADSWRWQSSNVNGYK 336 DP AK +L W+A LE+M SW WQS+N NGYK Sbjct: 301 DPDHAKTDLDWQATHSLEDMANSSWHWQSTNPNGYK 336 Lambda K H 0.315 0.134 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 468 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 339 Length of database: 337 Length adjustment: 28 Effective length of query: 311 Effective length of database: 309 Effective search space: 96099 Effective search space used: 96099 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate 200829 SO1664 (UDP-glucose 4-epimerase (NCBI ptt file))
to HMM TIGR01179 (galE: UDP-glucose 4-epimerase GalE (EC 5.1.3.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01179.hmm # target sequence database: /tmp/gapView.1621.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01179 [M=332] Accession: TIGR01179 Description: galE: UDP-glucose 4-epimerase GalE Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-147 475.6 0.0 3.6e-147 475.5 0.0 1.0 1 lcl|FitnessBrowser__MR1:200829 SO1664 UDP-glucose 4-epimerase ( Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__MR1:200829 SO1664 UDP-glucose 4-epimerase (NCBI ptt file) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 475.5 0.0 3.6e-147 3.6e-147 2 331 .. 3 334 .. 2 335 .. 0.99 Alignments for each domain: == domain 1 score: 475.5 bits; conditional E-value: 3.6e-147 TIGR01179 2 iLvtGgaGyiGshvvrqllekgkevvvlDnlskgskealkalekit..evklvegdladkekleavleeekidaviHfa 78 iLvtGgaGyiG h+v++ll++g ev+vlDnls++s eal ++e+it +v++++gd+ +k+ l++v+++++idaviHfa lcl|FitnessBrowser__MR1:200829 3 ILVTGGAGYIGTHTVVELLNAGSEVIVLDNLSNSSIEALDRVERITgkSVTFYQGDILNKALLQKVFSDHSIDAVIHFA 81 9********************************************9999****************************** PP TIGR01179 79 aliavgEsvkePlkYYennvvntleLleamqkagvkkliFsssaavYgesekvpisEesplnpinpYGrsklmvErilk 157 +l+avgEsv++PlkYYennv++tl L+++m++++vk+l+Fsssa+vYg++ ++pi+E++p++++npYG+sklmvE+il lcl|FitnessBrowser__MR1:200829 82 GLKAVGESVAKPLKYYENNVTGTLILCQVMAEFKVKNLVFSSSATVYGDPASLPITEDFPTGATNPYGQSKLMVEHILA 160 ******************************************************************************* PP TIGR01179 158 dlkkadkelkvviLRYFnvaGAdeegeiGeasknat.hliklvaevavgkrekleifGtdyptkDGtcvRDyiHveDla 235 dl+++d++++++ LRYFn++GA+ +g iGe++++++ +l++ +a+vavgkre+l++fG+dypt+DGt+vRDyiHv Dla lcl|FitnessBrowser__MR1:200829 161 DLHHSDPSWNIARLRYFNPVGAHASGLIGEDPNDIPnNLMPFIAQVAVGKREALSVFGNDYPTHDGTGVRDYIHVVDLA 239 ************************************9****************************************** PP TIGR01179 236 eaHlaalealeeggesevynlGagqgfsvkevieavkkvsgkdikveladrRaGDpaslvadaskikrelgwkpkyddL 314 +Hl+ale+l+++ + +ynlG+gqg+sv+++++a++k++gk+i++ +a+rR+GD+a+++ad++++k+ l+w++++ L lcl|FitnessBrowser__MR1:200829 240 IGHLKALEKLATKPGLVTYNLGTGQGYSVLDMVKAFEKACGKSIAYLIAPRRPGDIAACYADPDHAKTDLDWQATHS-L 317 ***************************************************************************99.* PP TIGR01179 315 eeiiksawdWekklkeg 331 e++ +s+w+W++++++g lcl|FitnessBrowser__MR1:200829 318 EDMANSSWHWQSTNPNG 334 *************9987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (332 nodes) Target sequences: 1 (337 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 6.36 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory