Align L-arabinose 1-dehydrogenase; D-galactose 1-dehydrogenase (EC 1.1.1.46; EC 1.1.1.48) (characterized)
to candidate 202371 SO3263 3-oxoacyl-(acyl-carrier-protein) reductase, putative (NCBI ptt file)
Query= reanno::acidovorax_3H11:Ac3H11_614 (280 letters) >FitnessBrowser__MR1:202371 Length = 255 Score = 103 bits (258), Expect = 3e-27 Identities = 76/247 (30%), Positives = 112/247 (45%), Gaps = 14/247 (5%) Query: 37 RAVFVTGGGSGIGAAIVAAFAEQGARVAFV-----DVAREASEALAQHIADAGLPRPWWR 91 + V +TGG GIGA I AFAE G VA D A + L +A L Sbjct: 14 KLVLITGGSRGIGAGIAKAFAEAGYWVAITYLNHQDKAVSLANILGDKVAAFAL------ 67 Query: 92 VCDVRDVQALQACMADAAAELGSDFAVLVNNVASDDRHTLESVTPEYYDERMAINERPAF 151 D ++++ C+ + VL+NN A +T + + + N R F Sbjct: 68 --DQSKPESIKQCITEVEKYFNRSIDVLINNGAIAQEKPFSDITADDFTTMLNTNLRGPF 125 Query: 152 FAIQAVVPGMRRLGAGSVINLGSTGWQGKGTGYPCYAIAKSSVNGLTRGLAKTLGQDRIR 211 QA +P M++ G G +IN+GS G Q G YA AK+ + L++ +AK +D IR Sbjct: 126 LLAQACIPAMQQHGFGRIINIGSIGGQWGGYNQVHYAAAKAGLINLSQSIAKIYSRDGIR 185 Query: 212 INTVSPGWVMTERQIKLWLDAEGEKELARNQCLPDKLRPHDIARMVLFLASDDAAMCTAQ 271 NT++ G V TE + L E K+ A + + DIA + LFLAS D+ + Q Sbjct: 186 TNTIAIGLVATE-MTEHELTTEAGKQKAAAIPVGRLGKVEDIASIALFLASQDSDYLSGQ 244 Query: 272 EFKVDAG 278 + G Sbjct: 245 TLNANGG 251 Lambda K H 0.320 0.133 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 112 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 280 Length of database: 255 Length adjustment: 25 Effective length of query: 255 Effective length of database: 230 Effective search space: 58650 Effective search space used: 58650 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory