Align butanoyl-CoA dehydrogenase (NAD+, ferredoxin) (subunit 1/3) (EC 1.3.1.109) (characterized)
to candidate 202254 SO3144 electron transfer flavoprotein, alpha subunit (NCBI ptt file)
Query= BRENDA::Q18AQ5 (336 letters) >FitnessBrowser__MR1:202254 Length = 308 Score = 162 bits (409), Expect = 1e-44 Identities = 113/326 (34%), Positives = 167/326 (51%), Gaps = 24/326 (7%) Query: 4 VLVVIEQRENVIQTVSLELLGKATEIAKDYDTKVSALLLGSKVEGLIDTLAHYGADEVIV 63 +LV+ E ++ + +++ A I D V G+ V+ A G +V+V Sbjct: 3 ILVLAEHDNAALKLDTAKVVTAARAIGDDIHVLVVGHQCGAVVQA---AQALQGVAQVLV 59 Query: 64 VDDEALAVYTTEPYTKAAYEAIKAADPIVVLFGATSIGRDLAPRVSARIHTGLTADCTGL 123 D+ + E K + + I L A+S G+D PR +A + ++ + Sbjct: 60 ADNSVYEAHLAENVAKLLVDLAPSYSHI--LAAASSAGKDTLPRAAALLDVAQISEVIAV 117 Query: 124 AVAEDTKLLLMTRPAFGGNIMATIVCKDFRPQMSTVRPGVMKKNEPDETKEAVINRFKVE 183 V+ DT RP + GN +AT+ D ++ TVR +A Sbjct: 118 -VSSDT----FVRPIYAGNALATVQSHD-AVKVMTVRASAF---------DAAAQGNSAA 162 Query: 184 FNDADKL----VQVVQVIKEAKKQVKIEDAKILVSAGRGMGGKENLDILYELAEIIGGEV 239 DK+ Q V + ++ +A I+VS GRGMG EN +L +LA+ +G V Sbjct: 163 VTTLDKVFAAKTQFVSQSLTVSARPELGNAGIIVSGGRGMGSGENFGMLEQLADKLGAAV 222 Query: 240 SGSRATIDAGWLDKARQVGQTGKTVRPDLYIACGISGAIQHIAGMEDAEFIVAINKNPEA 299 SRA +DAG++ QVGQTGK V P+LYIA GISGAIQH+AGM+DA+ IVAINK+PEA Sbjct: 223 GASRAAVDAGFVPNDLQVGQTGKIVAPNLYIAVGISGAIQHLAGMKDAKVIVAINKDPEA 282 Query: 300 PIFKYADVGIVGDVHKVLPELISQLS 325 PIF+ AD G+ D+ + +PELI+ LS Sbjct: 283 PIFQVADYGLEADLFEAVPELIACLS 308 Lambda K H 0.316 0.135 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 255 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 336 Length of database: 308 Length adjustment: 28 Effective length of query: 308 Effective length of database: 280 Effective search space: 86240 Effective search space used: 86240 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory