Align BadK (characterized)
to candidate 202993 SO3908 enoyl-CoA hydratase/isomerase family protein (NCBI ptt file)
Query= metacyc::MONOMER-943 (258 letters) >FitnessBrowser__MR1:202993 Length = 245 Score = 111 bits (277), Expect = 2e-29 Identities = 75/237 (31%), Positives = 120/237 (50%), Gaps = 3/237 (1%) Query: 14 VGIITLNRPDVLNALNDALMDALGGALLAFDADDGIGAIVIAGNTRAFAAGADIASMAAW 73 V II+ NRPD NAL+ + L L+ +AD+ I A ++ G F +G D+A Sbjct: 12 VRIISFNRPDKRNALDLNMYKQLTEYLIEGEADNDIRAFMLHGEDNCFTSGNDVADFL-- 69 Query: 74 SYSDVYGSNFITRNWETIRQIRKPVLAAVAGLAYGGGCELALACDIVIAGRSAKFALPEI 133 SD+ ++ R + +++KP++AAV+G A G G + L CD+V A SAKF LP + Sbjct: 70 KNSDLGPNHPAVRFLFCLLELKKPLVAAVSGAAVGIGTTVLLHCDLVYADNSAKFQLPFV 129 Query: 134 KLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLNAEEADRYGLVSRVVDDDRLRDETVAL 193 L L+P AG + LP +G KA ++ L +A A R +++ V+ + L Sbjct: 130 NLALVPEAGASLLLPELVGYQKAAELLLLGESFDANTAHRLNIINDVIAQEELLAYAFNQ 189 Query: 194 ATTIAAFSAPALMALKESLNRAFESTLAEGILFERRELHARFASADAREGIQAFLEK 250 A +A P + + L R ++ + + E + AR S +A+ QAFL+K Sbjct: 190 AKKLAN-QPPQALQITRQLMRPHKNRVQHQMHQELEQFGARLKSDEAKARFQAFLKK 245 Lambda K H 0.321 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 91 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 245 Length adjustment: 24 Effective length of query: 234 Effective length of database: 221 Effective search space: 51714 Effective search space used: 51714 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory