Align BadK (characterized)
to candidate 200845 SO1680 enoyl-CoA hydratase/isomerase family protein (NCBI ptt file)
Query= metacyc::MONOMER-943 (258 letters) >FitnessBrowser__MR1:200845 Length = 257 Score = 125 bits (314), Expect = 9e-34 Identities = 88/260 (33%), Positives = 129/260 (49%), Gaps = 13/260 (5%) Query: 6 ILTETQGRVGIITLNRPDVLNALNDALMDALGGALLAFDADDGIGAIVIAGN-TRAFAAG 64 ++ +G I+T+N P N + AL +L +A+ I A+V+ G + F+AG Sbjct: 4 LVERIEGHTAILTMNNPPA-NTWTAQSLQALKAKVLELNANKDIYALVLTGEGNKFFSAG 62 Query: 65 ADIASMA------AWSYSDVYGSNFITRNWETIRQIRKPVLAAVAGLAYGGGCELALACD 118 AD+ + A S + +G F ET+ Q R +AA+ G A GGG E+ALACD Sbjct: 63 ADLKLFSDGDKGNAASMAKHFGEAF-----ETLSQFRGVSIAAINGYAMGGGLEVALACD 117 Query: 119 IVIAGRSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLNAEEADRYGLVS 178 I IA A ALPE +GLLP AGGTQ L +G+ A M L +NA +A LV Sbjct: 118 IRIAETQAVMALPEATVGLLPCAGGTQNLTALVGEGWAKRMILCGERVNAAQALNLRLVE 177 Query: 179 RVVDDDRLRDETVALATTIAAFSAPALMALKESLNRAFESTLAEGILFERRELHARFASA 238 VV+ + +ALA +A S ++ A K + + ++ + E F + Sbjct: 178 EVVETGEALNAAIALAAKVANQSPSSVTACKTLIQAGRQMPRSQALPIEHELFVGLFDTE 237 Query: 239 DAREGIQAFLEKRAPCFSHR 258 D EG+ AFLEKR + +R Sbjct: 238 DQAEGVNAFLEKRKADWKNR 257 Lambda K H 0.321 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 107 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 257 Length adjustment: 24 Effective length of query: 234 Effective length of database: 233 Effective search space: 54522 Effective search space used: 54522 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory