Align Enoyl-CoA hydratase; EC 4.2.1.17 (characterized, see rationale)
to candidate 202205 SO3088 fatty oxidation complex, alpha subunit (NCBI ptt file)
Query= uniprot:A0A2Z5MCI7 (262 letters) >FitnessBrowser__MR1:202205 Length = 707 Score = 78.2 bits (191), Expect = 5e-19 Identities = 60/188 (31%), Positives = 93/188 (49%), Gaps = 8/188 (4%) Query: 18 VLTLSNPG-ARNALHPDMYAAGIEALDSVERDPSIRAVV-ITGADNFFCAGGNLNRLLE- 74 +LT+ PG N L + E L ++RD SIR +V I+G + F AG +++ L Sbjct: 18 ILTMDVPGETMNTLKAEFGPEISEILSEIKRDSSIRGLVLISGKKDSFVAGADISMLDAC 77 Query: 75 NRAKDPSVQAQSIDLLAEWISALRLSSKPVIAAVDGAAAGAGFSLALACDLIVAADDAKF 134 A D +Q ++ + AL + PV+AA+ GA G G LALAC V +DD K Sbjct: 78 QTAGDAKALSQQGHVVFNELEALNI---PVVAAIHGACLGGGLELALACHQRVCSDDGKT 134 Query: 135 VMSYARV--GLTPDGGGSWFLAQALPRQLATEVLIEGKPIGAARLHELGVVNKLTKPGTA 192 ++ V GL P GGG+ L + + A ++++ GK I + ++G+VN + Sbjct: 135 MLGVPEVQLGLLPGGGGTQRLPRLVGITTALDMMLTGKQIRPKQALKMGLVNDVVPQTIL 194 Query: 193 RDAAVAWA 200 AV A Sbjct: 195 LQTAVEMA 202 Lambda K H 0.317 0.132 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 333 Number of extensions: 21 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 707 Length adjustment: 32 Effective length of query: 230 Effective length of database: 675 Effective search space: 155250 Effective search space used: 155250 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory