Align Phenylacetyl-CoA:acceptor oxidoreductase small subunit PadC (characterized, see rationale)
to candidate 203435 SO4357 anaerobic dimethyl sulfoxide reductase, B subunit (NCBI ptt file)
Query= uniprot:A0A2R4BLY8 (215 letters) >FitnessBrowser__MR1:203435 Length = 205 Score = 111 bits (277), Expect = 1e-29 Identities = 64/186 (34%), Positives = 83/186 (44%), Gaps = 43/186 (23%) Query: 2 TRYAMVADLRRCVGCQTCTAACKHTNATPPGVQWR---------WVLDVEAGEFPDVSRT 52 T+Y D +C GC+TC ACK + G QWR W D + DV Sbjct: 5 TQYGFYVDTTKCSGCKTCQVACKDRSDIEVGKQWRRTYEYCGGNWTADGQGAYHQDVFAY 64 Query: 53 FVPVGCQHCDEPPCETVCPTTAT-KKRADGLVTIDYDLCIGCAYCSVACPYNARYKVNFA 111 ++ + C HC P C CPT A K+R+ GLV ++ DLCIGC C+ ACPY+A Sbjct: 65 YISISCNHCSNPVCVKACPTGAMYKERSTGLVKVNQDLCIGCESCARACPYDA------- 117 Query: 112 EPAYGDRLMANEKQRADPARVGVATKCTFCSDRIDYGVAHGLTPGVDPDATPACANACIA 171 + DP R V TKC CSDR+ G+ P+C +C Sbjct: 118 -------------PQIDPQR-KVMTKCDGCSDRVAKGL------------KPSCVMSCPQ 151 Query: 172 NALTFG 177 AL FG Sbjct: 152 RALDFG 157 Lambda K H 0.323 0.137 0.461 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 222 Number of extensions: 22 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 215 Length of database: 205 Length adjustment: 21 Effective length of query: 194 Effective length of database: 184 Effective search space: 35696 Effective search space used: 35696 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory