Align crotonase (EC 4.2.1.150) (characterized)
to candidate 202205 SO3088 fatty oxidation complex, alpha subunit (NCBI ptt file)
Query= metacyc::MONOMER-13469 (259 letters) >FitnessBrowser__MR1:202205 Length = 707 Score = 135 bits (340), Expect = 2e-36 Identities = 87/219 (39%), Positives = 132/219 (60%), Gaps = 9/219 (4%) Query: 5 NIILEKDGNVASITLNRP-KALNALNAATLKEIDAAINDIAEDDNVYA-VIITGSGKAFV 62 N+ +DG +A +T++ P + +N L A EI +++I D ++ V+I+G +FV Sbjct: 8 NLTRREDG-IAILTMDVPGETMNTLKAEFGPEISEILSEIKRDSSIRGLVLISGKKDSFV 66 Query: 63 AGADIAEMKDL-TAVEGRKFSVLGNKIFRKLENLEKPVIAAINGFALGGGCELSLSCDIR 121 AGADI+ + TA + + S G+ +F +LE L PV+AAI+G LGGG EL+L+C R Sbjct: 67 AGADISMLDACQTAGDAKALSQQGHVVFNELEALNIPVVAAIHGACLGGGLELALACHQR 126 Query: 122 IASSKAK--FGQPEVGLGITPGFGGTQRLARAIGVGMAKELIYTGKVINAEEALRIGLVN 179 + S K G PEV LG+ PG GGTQRL R +G+ A +++ TGK I ++AL++GLVN Sbjct: 127 VCSDDGKTMLGVPEVQLGLLPGGGGTQRLPRLVGITTALDMMLTGKQIRPKQALKMGLVN 186 Query: 180 KVVEPDKLLEEAKALVDAIIVNAPIAVRMCKAAINQGLQ 218 VV LL+ A V+ + IA + K+ +NQ L+ Sbjct: 187 DVVPQTILLQTA---VEMALAGKQIAKPVKKSLVNQLLE 222 Lambda K H 0.318 0.136 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 400 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 707 Length adjustment: 32 Effective length of query: 227 Effective length of database: 675 Effective search space: 153225 Effective search space used: 153225 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory