Align BilEA aka OpuBA protein, component of A proline/glycine betaine uptake system. Also reported to be a bile exclusion system that exports oxgall and other bile compounds, BilEA/EB or OpuBA/BB (required for normal virulence) (characterized)
to candidate 202699 SO3602 sulfate ABC transporter, ATP-binding protein (NCBI ptt file)
Query= TCDB::Q93A35 (328 letters) >FitnessBrowser__MR1:202699 Length = 376 Score = 181 bits (459), Expect = 3e-50 Identities = 105/267 (39%), Positives = 160/267 (59%), Gaps = 15/267 (5%) Query: 2 IRFDNVSKKYSDDKTAAVNNVTLDIKDGEFFVFIGPSGCGKTTTLKMINRLIPLTTGTIY 61 IR N+SKK+ + A++ + LDI++GE +GPSG GKTT L++I L +G I+ Sbjct: 3 IRLTNISKKFGQFQ--ALSPLNLDIQEGEMIGLLGPSGSGKTTLLRIIAGLEGADSGHIH 60 Query: 62 INEKRISDYDIHELRWDIGYVLQQIALFPHMTIEENIA----IVPELKKWSKEKIHDRIT 117 + ++ + + R +G+V Q ALF HMT+ +N+A ++P+ ++ S +I R++ Sbjct: 61 FGNRDVTQVHVRDRR--VGFVFQNYALFRHMTVADNVAFGLEVIPKKQRPSAAEIQKRVS 118 Query: 118 ELLDSVGLDPESYRHRKPAELSGGEQQRVGVVRALAADPGIILMDEPFSALDPISRQRLQ 177 LL+ V L + R+ P +LSGG++QR+ + RALA P ++L+DEPF ALD R+ L+ Sbjct: 119 HLLEMVQLGHLAQRY--PEQLSGGQKQRIALARALATQPEVLLLDEPFGALDAKVRKELR 176 Query: 178 QDISALQKKIKKTIVFVTHDMQEALALGDRICVMQGGEIVQVATPQEIMKNPENDFVKDF 237 + + +L ++K T VFVTHD EAL L DR+ VM G I QV TP E+ P + FV DF Sbjct: 177 RWLRSLHDELKFTSVFVTHDQDEALELSDRVVVMSNGNIEQVNTPIELYAQPNSRFVFDF 236 Query: 238 LASGHAFNTPILEANFTVNDLIEADLF 264 L + + F EAN+ N D F Sbjct: 237 LGNVNRF-----EANWQQNRWTNGDAF 258 Lambda K H 0.318 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 299 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 376 Length adjustment: 29 Effective length of query: 299 Effective length of database: 347 Effective search space: 103753 Effective search space used: 103753 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory