Align Putrescine-binding periplasmic protein SpuD (characterized)
to candidate 200448 SO1270 polyamine ABC transporter, periplasmic polyamine-binding protein (NCBI ptt file)
Query= SwissProt::Q02UB7 (367 letters) >FitnessBrowser__MR1:200448 Length = 367 Score = 435 bits (1119), Expect = e-127 Identities = 215/368 (58%), Positives = 283/368 (76%), Gaps = 3/368 (0%) Query: 2 MKRFGK-TLLALTLAGSVAGMAQAADNKVLHVYNWSDYIAPDTLEKFTKETGIKVVYDVY 60 MK F K T LAL AG++A +A A+ +V+ +YNWSDYIA DTLE F KETGI+V+YDV+ Sbjct: 1 MKLFNKMTTLALVTAGTLASVAVQAE-EVVRMYNWSDYIAEDTLENFKKETGIRVIYDVF 59 Query: 61 DSNEVLEAKLLAGKSGYDVVVPSNSFLAKQIKAGVYQKLDKSKLPNWKNLNKDLMHTLEV 120 DSNEV+EAKLL+G+SGYD+VVPSN FLAKQIKAG ++ LD+SKL N+KNLN DLM LE Sbjct: 60 DSNEVVEAKLLSGRSGYDIVVPSNHFLAKQIKAGAFKPLDRSKLTNFKNLNADLMKLLEK 119 Query: 121 SDPGNEHAIPYMWGTIGIGYNPDKVKAAFGDNAP-VDSWDLVFKPENIQKLKQCGVSFLD 179 +DPGN++A+PY+WGT GIGYN +KVKAA G++AP +S +L+F P+ +K+ +CG + LD Sbjct: 120 ADPGNQYAVPYLWGTNGIGYNINKVKAAVGEDAPPFNSMELIFNPKYAEKISKCGFAMLD 179 Query: 180 SPTEILPAALHYLGYKPDTDNPKELKAAEELFLKIRPYVTYFHSSKYISDLANGNICVAI 239 S +++P A+ YLG P++ ++ + A EL KIRPYVTYFHSS+YISDLANG+ICVA Sbjct: 180 SADDMVPQAMIYLGLDPNSTKAEDYEKAGELLEKIRPYVTYFHSSRYISDLANGDICVAY 239 Query: 240 GYSGDIYQAKSRAEEAKNKVTVKYNIPKEGAGSFFDMVAIPKDAENTEGALAFVNFLMKP 299 G+SGD++QA +RA+EA N + Y+IPKEGA +FDM+AIP DA N E A +N+L++P Sbjct: 240 GFSGDVFQAAARADEAGNGNKIGYSIPKEGANLWFDMLAIPADATNVENAHKLINYLLRP 299 Query: 300 EIMAEITDVVQFPNGNAAATPLVSEAIRNDPGIYPSEEVMKKLYTFPDLPAKTQRAMTRS 359 E++A I++ V + N N A PLV EAIRNDP IYP +EV+ KLY P K QR +TR Sbjct: 300 EVIAPISNYVAYANPNDLAQPLVDEAIRNDPAIYPPKEVLDKLYIGEIRPLKIQRVLTRV 359 Query: 360 WTKIKSGK 367 WTK+KSG+ Sbjct: 360 WTKVKSGQ 367 Lambda K H 0.315 0.133 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 463 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 367 Length adjustment: 30 Effective length of query: 337 Effective length of database: 337 Effective search space: 113569 Effective search space used: 113569 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory