Align L-lactaldehyde reductase (EC 1.1.1.77) (characterized)
to candidate 203967 SOA0164 iron-containing alcohol dehydrogenase (NCBI ptt file)
Query= metacyc::STM4044-MONOMER (382 letters) >FitnessBrowser__MR1:203967 Length = 383 Score = 328 bits (840), Expect = 2e-94 Identities = 178/383 (46%), Positives = 251/383 (65%), Gaps = 1/383 (0%) Query: 1 MSFMLALPKISLHGAGAIADMVNLVANKQWGKALIVTDGQLVKLGLLDSLFSALDEHQMS 60 MS +P +SL G AI + + + + KALIVTD LV + L+D L L H ++ Sbjct: 1 MSTTFYMPPMSLMGQHAIKLLGTELQARNFNKALIVTDKALVDIKLVDKLTDELSAHDIA 60 Query: 61 YHLFDEVFPNPTEELVQKGFAAYQSAECDYIIAFGGGSPIDTAKAVKILTANPGPSTAYS 120 + +FD V PNPTE+ + +G A ++ +CD++I+FGGGS D AK + ++ AN G YS Sbjct: 61 FAIFDGVKPNPTEKNIVQGLALLEAQKCDFVISFGGGSSHDCAKGIALVAANGGHIRDYS 120 Query: 121 -GVGKVKNAGVPLVAINTTAGTAAEMTSNAVIIDSARKVKEVIIDPNIIPDIAVDDASVM 179 GV +PLV +NTTAGTAAEMT A++ + + K I+D N+ P IAV+D+ +M Sbjct: 121 KGVHLSAKPQLPLVTVNTTAGTAAEMTIFAIVTNEEDETKYPIVDKNLTPIIAVNDSELM 180 Query: 180 LEIPASVTAATGMDALTHAVEAYVSVGAHPLTDANALEAIRLINLWLPKAVDDGHNLEAR 239 + +P +TAATGMDALTHAVEAYVS A P+TDA+A++AI LI L AVD+G + EAR Sbjct: 181 VAMPKFLTAATGMDALTHAVEAYVSTAATPITDASAIKAIELIAQNLKAAVDNGEDREAR 240 Query: 240 EQMAFGQYLAGMAFNSAGLGLVHALAHQPGATHNLPHGVCNAILLPIVENFNRPNAVARF 299 E M +G+YLAGMAF++A LG VH++AHQ G ++L HG+CNAILLP+V FN V RF Sbjct: 241 EAMQYGEYLAGMAFSNASLGYVHSMAHQLGGVYDLVHGLCNAILLPVVSRFNSAEKVERF 300 Query: 300 ARIAQAMGVETRGMSDEAASQEAINAIRTLSKRVGIPEGFSKLGVTKEDIEGWLDKALAD 359 A +A+AMGV+T GM+ A++ I AI LS VG + S LGV ++ +E AL D Sbjct: 301 AEVAKAMGVDTVGMTLIDAAESGILAIEKLSASVGTDQKLSDLGVKEDKLEFMAINALND 360 Query: 360 PCAPCNPRTASRDEVRGLYLEAL 382 C+ NPR A+ +++ ++ +A+ Sbjct: 361 ACSLTNPRKATTEDIINIFKKAM 383 Lambda K H 0.317 0.133 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 394 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 382 Length of database: 383 Length adjustment: 30 Effective length of query: 352 Effective length of database: 353 Effective search space: 124256 Effective search space used: 124256 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory