Align L-iditol 2-dehydrogenase (EC 1.1.1.14) (characterized)
to candidate 201911 SO2776 3-oxoacyl-(acyl-carrier-protein) reductase (NCBI ptt file)
Query= BRENDA::Q1J2J0 (255 letters) >FitnessBrowser__MR1:201911 Length = 248 Score = 154 bits (390), Expect = 1e-42 Identities = 99/243 (40%), Positives = 143/243 (58%), Gaps = 12/243 (4%) Query: 16 LDGRHALVTGGAQGIGFEIARGLAQAGARVTIADLNPDVGEGAAREL---DGTFERLNVT 72 L G+ ALVTG ++GIG IA L +AGA V I + G A +E G LNVT Sbjct: 7 LAGKVALVTGASRGIGRAIAETLVEAGA-VVIGTATSEKGAAAIQEYLGDKGFGLVLNVT 65 Query: 73 DADAVADL----ARRLPDVDVLVNNAGIVRNAPAEDTPDDDWRAVLSVNLDGVFWCCREF 128 D+ +V DL + DVD+LVNNAGI R+ DD+W ++ NL +F + Sbjct: 66 DSQSVTDLFDSIKEKAGDVDILVNNAGITRDNLLMRMKDDEWNDIIDTNLTSLFRLSKPV 125 Query: 129 GRTMLARGRGAIVSTASMSGLISNHPQPQAAYNASKAAVIHLTRSLAGEWASRGVRVNAV 188 RTM+ + G I++ S+ G + N Q Y+A+KA +I T+SLA E ASR + VNA+ Sbjct: 126 MRTMMKKRFGRIINIGSVVGTMGN--AGQVNYSAAKAGLIGFTKSLAREVASRQITVNAI 183 Query: 189 APGYTATPLTRRGLETPEWRETWLKETPLGRLAEPREIAPAVLYLASDAASFVTGHTLVV 248 APG+ T +T T + ++ + + P+ RL + +EIA AVL+LASD+A+++TG TL V Sbjct: 184 APGFIQTDMTDE--LTEDQQKAIMSQVPMERLGQAQEIANAVLFLASDSAAYITGETLHV 241 Query: 249 DGG 251 +GG Sbjct: 242 NGG 244 Lambda K H 0.319 0.134 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 162 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 248 Length adjustment: 24 Effective length of query: 231 Effective length of database: 224 Effective search space: 51744 Effective search space used: 51744 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory