Align Sorbitol dehydrogenase; SDH; Galactitol 2-dehydrogenase; L-iditol 2-dehydrogenase; Polyol dehydrogenase; EC 1.1.1.-; EC 1.1.1.16; EC 1.1.1.14 (characterized)
to candidate 202371 SO3263 3-oxoacyl-(acyl-carrier-protein) reductase, putative (NCBI ptt file)
Query= SwissProt::Q59787 (256 letters) >FitnessBrowser__MR1:202371 Length = 255 Score = 134 bits (337), Expect = 2e-36 Identities = 90/249 (36%), Positives = 130/249 (52%), Gaps = 13/249 (5%) Query: 6 KTALITGSARGIGRAFAEAYVREGARVAIADINLEAARATAAEI-GPAACAIALDVTDQA 64 K LITG +RGIG A+A+ G VAI +N + + A I G A ALD + Sbjct: 14 KLVLITGGSRGIGAGIAKAFAEAGYWVAITYLNHQDKAVSLANILGDKVAAFALDQSKPE 73 Query: 65 SIDRCVAELLDRWG-SIDILVNNAALFDLAPIVEITRESYDRLFAINVSGTLFMMQAVAR 123 SI +C+ E+ + SID+L+NN A+ P +IT + + + N+ G + QA Sbjct: 74 SIKQCITEVEKYFNRSIDVLINNGAIAQEKPFSDITADDFTTMLNTNLRGPFLLAQACIP 133 Query: 124 AMIAGGRGGKIINMASQAGRRGEALVGVYCATKAAVISLTQSAGLNLIRHGINVNAIAPG 183 AM G G +IIN+ S G+ G Y A KA +I+L+QS R GI N IA G Sbjct: 134 AMQQHGFG-RIINIGSIGGQWGGYNQVHYAAAKAGLINLSQSIAKIYSRDGIRTNTIAIG 192 Query: 184 VVDGEHWDGVDAKFADYENLPRGEKKRQVGAAVPFGRMGRAEDLTGMAIFLATPEADYIV 243 +V E E+ E +Q AA+P GR+G+ ED+ +A+FLA+ ++DY+ Sbjct: 193 LVATEMT----------EHELTTEAGKQKAAAIPVGRLGKVEDIASIALFLASQDSDYLS 242 Query: 244 AQTYNVDGG 252 QT N +GG Sbjct: 243 GQTLNANGG 251 Lambda K H 0.321 0.135 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 164 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 255 Length adjustment: 24 Effective length of query: 232 Effective length of database: 231 Effective search space: 53592 Effective search space used: 53592 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory