Align dicarboxylate TRAP transporter (succinate, fumarate, L-malate, and alpha-ketoglutarate), small permease component (characterized)
to candidate 202249 SO3135 C4-dicarboxylate transporter, putative (NCBI ptt file)
Query= reanno::PV4:5208944 (212 letters) >FitnessBrowser__MR1:202249 Length = 219 Score = 290 bits (743), Expect = 1e-83 Identities = 137/201 (68%), Positives = 164/201 (81%) Query: 1 MMSRFFSHIEEVVLNALITAMTLLVFVEVIARFFFNTGFLWIQELTLTICGWFVLFGMSY 60 M++R F + EE VLN LIT MTLLVF EV+ARFFF+TGFLWIQELTLT+CGWFVLFGMSY Sbjct: 1 MIARIFGYFEEGVLNLLITLMTLLVFTEVVARFFFDTGFLWIQELTLTLCGWFVLFGMSY 60 Query: 61 GVKVGAHIGVDAFVKKLPAQGRKYTAILAVAICLIYCGMFLVGSWDYLAKMYQIGVPMED 120 GVKVGAHIGVDA VKKLP +K T+++ ICL YC +FL GSW YL++MYQIGVPMED Sbjct: 61 GVKVGAHIGVDALVKKLPPNAKKITSLITTLICLTYCILFLKGSWSYLSQMYQIGVPMED 120 Query: 121 IDLPHFLIGGLDGDFAWEYLRIDVEEPAVPLWTSQSILLIGFILLTWRFLQLALAIITNK 180 I P +L+ LD D+AW L+ID+E+ AVP+W SQSILLIGF +LTWRF++L +AI+ N+ Sbjct: 121 IHFPAWLLARLDPDWAWNVLKIDIEDGAVPIWISQSILLIGFSMLTWRFIELFVAILRNQ 180 Query: 181 TDGFAFADEAKESMHLIDQEA 201 G +FADEAKESMHLID A Sbjct: 181 VTGLSFADEAKESMHLIDDTA 201 Lambda K H 0.329 0.144 0.453 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 230 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 212 Length of database: 219 Length adjustment: 22 Effective length of query: 190 Effective length of database: 197 Effective search space: 37430 Effective search space used: 37430 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory