GapMind for catabolism of small carbon sources

 

Aligments for a candidate for ams in Shewanella oneidensis MR-1

Align Alpha-glucosidase; EC 3.2.1.20 (characterized, see rationale)
to candidate 201365 SO2213 oligo-1,6-glucosidase (NCBI ptt file)

Query= uniprot:H3K096
         (538 letters)



>lcl|FitnessBrowser__MR1:201365 SO2213 oligo-1,6-glucosidase (NCBI
           ptt file)
          Length = 540

 Score =  644 bits (1662), Expect = 0.0
 Identities = 300/537 (55%), Positives = 379/537 (70%), Gaps = 3/537 (0%)

Query: 5   MMWWRGGVIYQIYPRSFLDSRGDGVGDLNGITEKLDYVASLNVDGIWLSPFFTSPMLDFG 64
           + WWRG VIYQIYPRS LD+ GDGVGDL GI  KLDY+ASLNVD IW+SPFF SPM DFG
Sbjct: 4   LTWWRGAVIYQIYPRSLLDTNGDGVGDLRGIITKLDYIASLNVDAIWISPFFKSPMADFG 63

Query: 65  YDVSDYRDVDPMFGTLEDFKALLEKAHSLGLKVMIDQVISHTSDQHPWFQESRQNRTNPK 124
           YD+SDYR++DP+FG+++DF  L+EKAH  G+KV+IDQV+SHTSDQH WF ESR++RTNPK
Sbjct: 64  YDISDYREIDPLFGSMQDFDELIEKAHQRGIKVIIDQVLSHTSDQHAWFIESRESRTNPK 123

Query: 125 ADWFVWADPKPDGTPPNNWLSIFGGSAWTFDSRRQQYYLHNFLTSQPDVNFHHPEARQAQ 184
           ADW+VWADP+ DGTPPNNWL+IFGG AW ++ RRQQYYLHNFL SQPD+NFH+P+ RQA 
Sbjct: 124 ADWYVWADPREDGTPPNNWLAIFGGCAWEWEPRRQQYYLHNFLRSQPDINFHNPDVRQAV 183

Query: 185 LDNMRFWLDLGVDGFRLDTVNFYFHDAELRDNPPVPKGEAKTLGAPEANPYTWQRHVYDL 244
           LDN+ FWL  GVDGFRLD + F FHD  LRDNP  PK + +  G  E NPY +Q H Y+ 
Sbjct: 184 LDNVEFWLKKGVDGFRLDAITFCFHDELLRDNPAKPKEKRQGRGFSEDNPYAYQYHYYNN 243

Query: 245 SRPENLDFLKDLRALMDEYPGTTTVGEIGDDNPLERMAEYTAGGDKLHMAYTFDLLNMPH 304
            RP+ + F++ LR L++ YPGT T+GE+  ++ L  MA YT G D+LHMAY+F+LL   +
Sbjct: 244 DRPQTIQFIEALRQLINRYPGTVTLGEVSAEDSLAVMAAYTKGDDRLHMAYSFELLTDDY 303

Query: 305 SASYLREVIERFQRLAGDAWPCWATSNHDVVRSATRWGADEDPHAYPKVMLAVLFSLRGS 364
           SA+Y+R+ +E  +   GD WPCWA  NHDV R A+RWG  +      K++ A+L SLRGS
Sbjct: 304 SAAYIRQTVEALENSIGDGWPCWAIGNHDVQRVASRWGRGKQTSDMAKMLNAMLCSLRGS 363

Query: 365 VCLYQGEELGLPEADVPFERIQDPYGKVLWPEFKGRDGCRTPMPWTD-GEQGGFSPVEPW 423
           VC YQGEELGL E  + F  +QDP+GK  WP FKGRDGCRTPMPW    +  GFS V PW
Sbjct: 364 VCSYQGEELGLTEVPIEFHELQDPFGKTFWPMFKGRDGCRTPMPWEQYADFSGFSQVSPW 423

Query: 424 LPMEARHLELAVSRQQDDPNATLNTVRALLAFRRSHPALFDGDLSLVDVGDDLLGFTRQK 483
           LP+ A H  LAV  Q+ D ++ L+  R  LA+R+ +PAL   ++  +D  + LL F R+ 
Sbjct: 424 LPIAAAHRALAVDLQEADCHSVLHGYRQFLAWRKCYPALITSEIEFLDAPEPLLVFVRKL 483

Query: 484 GDETLLCVFNLTGQEQQTTLPVEVASDLPVAH--FTATRDGSTLTLPAYQAAFMQVA 538
           G++ LL  FNL   E Q +L           H   TA R G +L   AY + +  +A
Sbjct: 484 GEQKLLVCFNLLDAETQLSLTGLKLQQELAGHGLKTAHRQGDSLIFSAYASFYALLA 540


Lambda     K      H
   0.320    0.138    0.443 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 953
Number of extensions: 36
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 538
Length of database: 540
Length adjustment: 35
Effective length of query: 503
Effective length of database: 505
Effective search space:   254015
Effective search space used:   254015
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory