Align lactoylglutathione lyase (EC 4.4.1.5) (characterized)
to candidate 200898 SO1734 glyoxalase family protein (NCBI ptt file)
Query= BRENDA::Q8ZM36 (144 letters) >FitnessBrowser__MR1:200898 Length = 131 Score = 148 bits (374), Expect = 3e-41 Identities = 74/126 (58%), Positives = 91/126 (72%) Query: 19 MIIDRIDHLVLTVSDISTTIRFYEEVLGFSAVTFKQNRKALIFGAQKINLHQQEMEFEPK 78 M + R+DHLVLTV DI T++ FY+ VLG F Q R AL FG QKINLHQ EFEPK Sbjct: 1 MRVTRLDHLVLTVKDIETSVGFYQCVLGMKKSVFGQGRIALSFGDQKINLHQAGAEFEPK 60 Query: 79 ASRPTPGSADLCFITSTPINDVVSEILQAGISIVEGPVERTGATGEIMSIYIRDPDGNLI 138 A+ TPGSADLCF+ S I +V+S + + I+EGPV RTGATG I S+YIRDPD NL+ Sbjct: 61 ANLATPGSADLCFVVSHNIEEVISHLNALEVEIIEGPVLRTGATGRINSVYIRDPDLNLL 120 Query: 139 EISQYV 144 E+S+Y+ Sbjct: 121 ELSEYL 126 Lambda K H 0.321 0.137 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 70 Number of extensions: 1 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 144 Length of database: 131 Length adjustment: 15 Effective length of query: 129 Effective length of database: 116 Effective search space: 14964 Effective search space used: 14964 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 42 (20.8 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory