Align hydroxyacylglutathione hydrolase; EC 3.1.2.6 (characterized)
to candidate 201703 SO2563 metallo-beta-lactamase family protein (NCBI ptt file)
Query= CharProtDB::CH_024825 (251 letters) >FitnessBrowser__MR1:201703 Length = 267 Score = 191 bits (485), Expect = 1e-53 Identities = 109/266 (40%), Positives = 148/266 (55%), Gaps = 15/266 (5%) Query: 1 MNLNSIPAFDDNYIWVLNDEAGRCL-IVDPGDAEPVLNAIAANNWQPEAIFLTHHHHDHV 59 + + +I AF+DNYIWVL + + + +VDPGD VL+ + A+ I +THHH DH Sbjct: 2 LTITAINAFNDNYIWVLQQDTQQAVYVVDPGDVNVVLDYLNAHQLTLAGILITHHHRDHT 61 Query: 60 GGVKELVEKFPQ-----IVVYGPQETQDKGTTQVVKDGETAFV----LGHEFSVIATPGH 110 GG+ LV Q + VYGPQ +G ++ T + L V++ PGH Sbjct: 62 GGIAALVAYVEQTTGHTLAVYGPQSEAIQGVNIAIEPQITQILHLPFLNSPVQVLSVPGH 121 Query: 111 TLGHICYFSKPYLFCGDTLFSGGCGRLFEGTASQMYQSLKKLSALPDDTLVCCAHEYTLS 170 T GHI Y LFCGDTLFSGGCGRLFEGT +QM SL+ L+ALP +T V CAHEYTL+ Sbjct: 122 TAGHIAYLVDGALFCGDTLFSGGCGRLFEGTPAQMCHSLRLLAALPAETRVYCAHEYTLA 181 Query: 171 NMKFALSILPHDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINE 230 N+KFA + P + + Y + LRA+ + T+P + ER IN FLR +++ I + Sbjct: 182 NLKFAQAADPSNAKLKAYNEQATALRAQGKATIPSTIGLERSINPFLRGLTPTIVDSIKQ 241 Query: 231 ETLLQQPEE-----RFAWLRSKKDRF 251 + Q F LR KD F Sbjct: 242 QFCDQDLSNVDELTYFTLLRQWKDIF 267 Lambda K H 0.321 0.138 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 225 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 251 Length of database: 267 Length adjustment: 24 Effective length of query: 227 Effective length of database: 243 Effective search space: 55161 Effective search space used: 55161 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
Align candidate 201703 SO2563 (metallo-beta-lactamase family protein (NCBI ptt file))
to HMM TIGR03413 (gloB: hydroxyacylglutathione hydrolase (EC 3.1.2.6))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03413.hmm # target sequence database: /tmp/gapView.6375.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03413 [M=248] Accession: TIGR03413 Description: GSH_gloB: hydroxyacylglutathione hydrolase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.7e-96 306.2 0.0 8.7e-96 306.0 0.0 1.0 1 lcl|FitnessBrowser__MR1:201703 SO2563 metallo-beta-lactamase fa Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__MR1:201703 SO2563 metallo-beta-lactamase family protein (NCBI ptt file) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 306.0 0.0 8.7e-96 8.7e-96 1 248 [] 4 267 .] 4 267 .] 0.92 Alignments for each domain: == domain 1 score: 306.0 bits; conditional E-value: 8.7e-96 TIGR03413 1 iiaipalsdNyiwllkdeks.eavvvDpgeaepvlealeekglkleaillTHhHaDHvggvaellekfp......vkvv 72 i+ai+a++dNyiw+l+++++ +++vvDpg+ + vl++l++++l+l+ il+THhH+DH+gg+a+l++ ++ ++v+ lcl|FitnessBrowser__MR1:201703 4 ITAINAFNDNYIWVLQQDTQqAVYVVDPGDVNVVLDYLNAHQLTLAGILITHHHRDHTGGIAALVAYVEqttghtLAVY 82 689*************99997999***************************************98654333246689** PP TIGR03413 73 gpaeeripgltkevkeg....devellelevevlevpGHtlgHiayyleeekvlFcgDtLfsaGCGrlfegtaeqmles 147 gp++e+i+g++ +++ + ++ +l++ v+vl+vpGHt+gHiay+++ ++lFcgDtLfs GCGrlfegt++qm +s lcl|FitnessBrowser__MR1:201703 83 GPQSEAIQGVNIAIEPQitqiLHLPFLNSPVQVLSVPGHTAGHIAYLVD--GALFCGDTLFSGGCGRLFEGTPAQMCHS 159 ********9998887552100345569**********************..**************************** PP TIGR03413 148 lqklaaLpeetkvycaHEYtlsNlrFalavepenealkerlkevealrakgkptlPstlaeekatNpFLraeeaevkaa 226 l+ laaLp+et+vycaHEYtl+Nl+Fa+a++p+n++lk++ ++++alra+gk+t+Pst++ e+++NpFLr ++++ + lcl|FitnessBrowser__MR1:201703 160 LRLLAALPAETRVYCAHEYTLANLKFAQAADPSNAKLKAYNEQATALRAQGKATIPSTIGLERSINPFLRGLTPTIVDS 238 ****************************************************************************999 PP TIGR03413 227 lee.......ekaeevevfaelRekkdkf 248 +++ ++ +e++ f+ lR++kd f lcl|FitnessBrowser__MR1:201703 239 IKQqfcdqdlSNVDELTYFTLLRQWKDIF 267 999999999889999************87 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (248 nodes) Target sequences: 1 (267 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 9.69 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory