GapMind for catabolism of small carbon sources

 

Aligments for a candidate for ackA in Shewanella oneidensis MR-1

Align acetate kinase (EC 2.7.2.1) (characterized)
to candidate 202039 SO2915 acetate kinase (NCBI ptt file)

Query= BRENDA::E3W769
         (401 letters)



>lcl|FitnessBrowser__MR1:202039 SO2915 acetate kinase (NCBI ptt
           file)
          Length = 399

 Score =  677 bits (1746), Expect = 0.0
 Identities = 332/399 (83%), Positives = 370/399 (92%), Gaps = 1/399 (0%)

Query: 1   MSDKLVLVLNCGSSSLKFAIIDAQSGDDKISGLAECFGLEDSRIKWKFNGGKNEAKLGAF 60
           MS+KLVLVLNCGSSSLKFA+IDAQ+GDD+ISGLAECFGLEDSRIKWK NG K+E+ LGAF
Sbjct: 1   MSNKLVLVLNCGSSSLKFAVIDAQTGDDQISGLAECFGLEDSRIKWKINGEKHESSLGAF 60

Query: 61  TAHREAVEFFIVNNILAEHPELAAQIKAIGHRIVHGGEKFTRSVIITPEVIQGIEDCASL 120
           TAHREAVEF IVN ILA  PELAAQI+A+GHRIVHGGEKFTRSVII   VI+GIE+C+SL
Sbjct: 61  TAHREAVEF-IVNKILAGQPELAAQIQAVGHRIVHGGEKFTRSVIIDEHVIKGIEECSSL 119

Query: 121 APLHNPAHLIGIRAAIASFPQLPQVTVFDTAFHQTMPEKAYIYALPYKLYREHSIRRYGM 180
           APLHNPAHLIGIRAA+ASFP+LPQV VFDTAFHQ+MPE+++IYALPYKLYREH IRRYGM
Sbjct: 120 APLHNPAHLIGIRAAMASFPKLPQVAVFDTAFHQSMPERSFIYALPYKLYREHGIRRYGM 179

Query: 181 HGTSHFYVCREAAKVLGKDVKDINVICAHLGNGASVAAIKGGKSVDTSMGLTPLEGLVMG 240
           HGTSH +V REAAKVL K + + NVICAHLGNGASV A+KGGKSVDTSMGLTPLEGLVMG
Sbjct: 180 HGTSHLFVSREAAKVLKKPLAETNVICAHLGNGASVTAVKGGKSVDTSMGLTPLEGLVMG 239

Query: 241 TRCGDLDPSIIFHLVKQLGYTLDEVNNLLNKQSGLLGISELTNDCRGIEEGYHDGHKGAT 300
           TRCGD+DPSII+HLV QLGYTL+EVNNL+NKQSGLLGISELTNDCRGIEEGY DGHKGAT
Sbjct: 240 TRCGDIDPSIIYHLVHQLGYTLEEVNNLMNKQSGLLGISELTNDCRGIEEGYADGHKGAT 299

Query: 301 LALDIFCYRLAKYIASYTVPLGRLDAIIFTGGIGENSNLIREKVLNLLEIFNFKVDDILN 360
           LAL+IFCYRLAKYIASYTVPLGRLDA++FTGGIGENS++IREKVLN+L+IFNF VD   N
Sbjct: 300 LALEIFCYRLAKYIASYTVPLGRLDAVVFTGGIGENSDIIREKVLNMLQIFNFHVDSERN 359

Query: 361 KAARFGQQGVITQAGTPIAMVIPTNEEWVIAEDAIKLIT 399
           KAARFG++G+IT   + +AMVIPTNEEWVIAED+IKLIT
Sbjct: 360 KAARFGKKGIITADNSTVAMVIPTNEEWVIAEDSIKLIT 398


Lambda     K      H
   0.321    0.139    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 617
Number of extensions: 17
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 401
Length of database: 399
Length adjustment: 31
Effective length of query: 370
Effective length of database: 368
Effective search space:   136160
Effective search space used:   136160
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.9 bits)

Align candidate 202039 SO2915 (acetate kinase (NCBI ptt file))
to HMM TIGR00016 (ackA: acetate kinase (EC 2.7.2.1))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR00016.hmm
# target sequence database:        /tmp/gapView.7754.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00016  [M=405]
Accession:   TIGR00016
Description: ackA: acetate kinase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                       -----------
   5.7e-170  551.3   0.2   6.5e-170  551.1   0.2    1.0  1  lcl|FitnessBrowser__MR1:202039  SO2915 acetate kinase (NCBI ptt 


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__MR1:202039  SO2915 acetate kinase (NCBI ptt file)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  551.1   0.2  6.5e-170  6.5e-170       2     404 ..       2     397 ..       1     398 [. 0.98

  Alignments for each domain:
  == domain 1  score: 551.1 bits;  conditional E-value: 6.5e-170
                       TIGR00016   2 kskkilvlnaGssslkfalldaensekvllsglverikleeariktvedgekkeeeklaiedheeavkkllntlkkdkk 80 
                                     ++k++lvln+Gssslkfa++da++++   +sgl+e++ le++rik++ +gek+e+   a+++h+eav++++n++ +   
  lcl|FitnessBrowser__MR1:202039   2 SNKLVLVLNCGSSSLKFAVIDAQTGDDQ-ISGLAECFGLEDSRIKWKINGEKHESSLGAFTAHREAVEFIVNKILA--G 77 
                                     6799********************9999.9*********************************************7..5 PP

                       TIGR00016  81 ilkelseialiGHRvvhGgekftesvivtdevlkkikdiselAPlHnpaelegieavlklkvllkaknvavFDtafHqt 159
                                       ++ ++i+++GHR+vhGgekft svi++++v+k+i++ s+lAPlHnpa+l+gi+a++     +k ++vavFDtafHq 
  lcl|FitnessBrowser__MR1:202039  78 QPELAAQIQAVGHRIVHGGEKFTRSVIIDEHVIKGIEECSSLAPLHNPAHLIGIRAAM--ASFPKLPQVAVFDTAFHQS 154
                                     59********************************************************..6677889************ PP

                       TIGR00016 160 ipeeaylYalPyslykelgvRrYGfHGtshkyvtqraakllnkplddlnlivcHlGnGasvsavknGksidtsmGltPL 238
                                     +pe++++YalPy+ly+e+g+RrYG+HGtsh +v+++aak+l kpl++ n+i +HlGnGasv+avk Gks+dtsmGltPL
  lcl|FitnessBrowser__MR1:202039 155 MPERSFIYALPYKLYREHGIRRYGMHGTSHLFVSREAAKVLKKPLAETNVICAHLGNGASVTAVKGGKSVDTSMGLTPL 233
                                     ******************************************************************************* PP

                       TIGR00016 239 eGlvmGtRsGdiDpaiisylaetlglsldeieetlnkksGllgisglssDlRdildkkeegneeaklAlkvyvhRiaky 317
                                     eGlvmGtR+GdiDp+ii +l ++lg +l+e+++++nk+sGllgis+l++D+R i++ +++g++ a+lAl+++++R+aky
  lcl|FitnessBrowser__MR1:202039 234 EGLVMGTRCGDIDPSIIYHLVHQLGYTLEEVNNLMNKQSGLLGISELTNDCRGIEEGYADGHKGATLALEIFCYRLAKY 312
                                     ******************************************************************************* PP

                       TIGR00016 318 igkyiaslegelDaivFtgGiGenaaevrelvleklevlGlkldlelnnaarsgkesvisteeskvkvlviptneelvi 396
                                     i++y+  l g+lDa+vFtgGiGen+  +re+vl+ l+++ +++d+e+n+aar+gk+++i+ ++s+v ++viptnee+vi
  lcl|FitnessBrowser__MR1:202039 313 IASYTVPL-GRLDAVVFTGGIGENSDIIREKVLNMLQIFNFHVDSERNKAARFGKKGIITADNSTV-AMVIPTNEEWVI 389
                                     ********.67*************************************************999987.689********* PP

                       TIGR00016 397 aeDalrla 404
                                     aeD+++l+
  lcl|FitnessBrowser__MR1:202039 390 AEDSIKLI 397
                                     *****997 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (405 nodes)
Target sequences:                          1  (399 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02
# Mc/sec: 6.81
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory